SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031HL69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031HL69
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.17e-33
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 341-397
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 3.79e-16
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0025
Further Details:      
 
Domain Number 3 Region: 243-326
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0000000000109
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A031HL69
Sequence length 399
Comment (tr|A0A031HL69|A0A031HL69_MICLU) UDP-N-acetylmuramate dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00037} KW=Complete proteome OX=1270 OS=Micrococcus luteus (Micrococcus lysodeikticus). GN=BW40_02267 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Micrococcus.
Sequence
MSERLADHTTTRVGGPARAWVTARTEAEAIEAVRAADAAGEPLFVLGGGSNTLMADAGFP
GTVVRLAFEGIHVLDGPVPGEGETPPAGDGARPADHEGEAVDVRVAAGHPWDDAVAWTVA
HGLGGIEALSGIPGSAGATPVQNVGAYGADVSQVLVALRAWDREAGDLVELTPADLRFGY
RDSVIKRSMLETGAPSPRWMVLSIDLRLRRASSDAEPTAPVRYGQLAAALDVEEGAHAPL
AVVRREVLALRTAKGMVSDPADPDTWSTGSYFTNPIVPASVRASLPEGAPAFAAGEAEDG
TPLVKLSAAWLIDRAGFAKGFGLPEVGPREGGPDGRGADGAGLAGGRASVSTKHTLAMTN
RGDATTEDVLTIARTVRDGVRERFGVELHPEPMIIGTSL
Download sequence
Identical sequences A0A031HL69
WP_036317707.1.56499 WP_036317707.1.9158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]