SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031I7J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031I7J5
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.96e-52
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000301
Further Details:      
 
Domain Number 2 Region: 169-221
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000000165
Family Peptidoglycan binding domain, PGBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031I7J5
Sequence length 229
Comment (tr|A0A031I7J5|A0A031I7J5_9SPHN) N-acetylmuramoyl-L-alanine amidase family protein {ECO:0000313|EMBL:EZP57168.1} KW=Complete proteome OX=1470591 OS=Sphingomonas sp. RIT328. GN=BW41_00010 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MTILDTPSPNFDERSLPISMIVLHYTGMQDGPSALARLRDPEAKVSAHYLVEEDGTVCRL
VAEQDRAWHAGRSSWRGITDVNSASVGIEIVNPGHDWGYRPFTEEQIAALIPLVAAIKER
HGITRGNIVGHSDIAPARKRDPGELFPWGKLARLRLALPRPTRNLLDPMWTQGGFLLALE
RFGYDVSDAMAAIMAFQRRYRPELIDGEIDAECRMILLALLLPKPQGDH
Download sequence
Identical sequences A0A031I7J5
WP_037530096.1.17274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]