SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031JLK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031JLK8
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2e-34
Family Ribosomal protein S14 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031JLK8
Sequence length 101
Comment (tr|A0A031JLK8|A0A031JLK8_SPHPI) 30S ribosomal protein S14 {ECO:0000256|HAMAP-Rule:MF_00537} KW=Complete proteome OX=13689 OS=Sphingomonas paucimobilis (Pseudomonas paucimobilis). GN=BV96_01031 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MAKLSSINKNERRKKLVKKYAGRYAKLKAIANDTAADDSDRLIARLKMAEIPRNGNPTRI
RNRCELTGRPRAYYRKFRLCRVQLRDLANKGLIPGVTKSSW
Download sequence
Identical sequences A0A031JLK8 A0A2A5YMC9 A0A2E2A539 Q1N7Y1 T0HQZ3 T0IKZ8
WP_009820643.1.15727 WP_009820643.1.20974 WP_009820643.1.28070 WP_009820643.1.35683 WP_009820643.1.46872 WP_009820643.1.508 WP_009820643.1.52800 WP_009820643.1.63206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]