SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031K2L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031K2L0
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily N-terminal domain of the delta subunit of the F1F0-ATP synthase 4.05e-25
Family N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.0028
Further Details:      
 
Weak hits

Sequence:  A0A031K2L0
Domain Number - Region: 144-182
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0366
Family V-type ATPase subunit E 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031K2L0
Sequence length 184
Comment (tr|A0A031K2L0|A0A031K2L0_9SPHN) F-type ATPase subunit delta {ECO:0000256|HAMAP-Rule:MF_01416} KW=Complete proteome OX=158500 OS=Novosphingobium resinovorum. GN=BES08_05280 OC=Sphingomonadaceae; Novosphingobium.
Sequence
MENSGGIKASLQGRYASALFDLASENGSVSAVENDLDNLGQALRESDELAALIRNPQISR
DAAAKAIEAVAGVLGTSPLTKNFLGVLAGNRRLSALPEIIRAFASIAAAQRGEATAEVAS
AHALSDEQVEQLRQKLEVREGRKVKIKTSVDPELLGGLVVTIGSKRIDSSIRTRLNSLAQ
AMKG
Download sequence
Identical sequences A0A031K2L0 J8VIH7
WP_008830032.1.19619 WP_008830032.1.70379 WP_008830032.1.75502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]