SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A031LS52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031LS52
Domain Number 1 Region: 391-477
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A031LS52
Sequence length 481
Comment (tr|A0A031LS52|A0A031LS52_9GAMM) Sulfate transporter {ECO:0000313|EMBL:EZQ11207.1} KW=Complete proteome; Reference proteome OX=466088 OS=Acinetobacter sp. Ver3. GN=CL42_05550 OC=Moraxellaceae; Acinetobacter.
Sequence
MIYLKKDQWFSNIRTDVLAGLVVGLALIPESIAFSAIAGVDPQVGLYASFCIAVTIAFFG
GRTAMISAATGAMALLMITLVKEHGLQYLLAATILTGVIQIIAGYLKVAKLMRFVSQSVV
YGFLNALAILIFIAQFPEIAQMNSLGYIFLAIGLLVIYAFPHLPKIGKIIPSPLVCIIVL
SVLALLLGADMRTVSDLGAFPDTLPVFLIPEIPFSLDTLLIILPYSLTLATVGLLETMMT
TTVIDEMTESEGDRHQECRGQGIANMVSGFMGGMAGCAMIGQSIINVSSGARTRLSTLVA
GVFLLCLVVFFKDWLAYIPMAALVAIMIMVAFTTFNWDSVKNFRKHPVQSNVVMLTVVMI
VLATHNLALGVLIGVILSALFLINKLESEVKVQSELENHVRYYTVKGQIFFSSAEIFYAF
FDFKEDIKQVEIDLSYAHIWDITSVNMLANVVAKFEAQGTQVRVIGLNQASVTLIERISN
T
Download sequence
Identical sequences A0A031LS52
WP_035265905.1.47779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]