SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A031WJE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031WJE5
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.45e-34
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031WJE5
Sequence length 179
Comment (tr|A0A031WJE5|A0A031WJE5_CLODI) Pyruvate synthase subunit porC {ECO:0000313|EMBL:SJP75943.1} KW=Complete proteome OX=1496 OS=Clostridioides difficile (Peptoclostridium difficile). GN=BGU81_03825 OC=Peptostreptococcaceae; Clostridioides.
Sequence
MEKELVFAGFGGQGVLTLGLIVAESALELGKQVTWMPAYGPTMRGGKAYSVVKFSDESIG
GPDMEEIDVLVAMNKPSLDYINLVKEGGTVVINTSAIDENVTLREDISVVKINCQELAQK
VNNPKAANIVVLGALIAKTGLFEKELALKTMCDFFEEKGKGKFNVQNEAAFMEGYNNAI
Download sequence
Identical sequences A0A031WJE5 A0A125V771 Q185Y4 T4AU92
APC62665 WP_003433888.1.100055 WP_003433888.1.100107 WP_003433888.1.100118 WP_003433888.1.100513 WP_003433888.1.100570 WP_003433888.1.100660 WP_003433888.1.100923 WP_003433888.1.100977 WP_003433888.1.101035 WP_003433888.1.101125 WP_003433888.1.101279 WP_003433888.1.101316 WP_003433888.1.101532 WP_003433888.1.101861 WP_003433888.1.102031 WP_003433888.1.102074 WP_003433888.1.102095 WP_003433888.1.10483 WP_003433888.1.10582 WP_003433888.1.10691 WP_003433888.1.10793 WP_003433888.1.10795 WP_003433888.1.11224 WP_003433888.1.11278 WP_003433888.1.11320 WP_003433888.1.11398 WP_003433888.1.1167 WP_003433888.1.1179 WP_003433888.1.11937 WP_003433888.1.11954 WP_003433888.1.11959 WP_003433888.1.12066 WP_003433888.1.12385 WP_003433888.1.1254 WP_003433888.1.12629 WP_003433888.1.12632 WP_003433888.1.12659 WP_003433888.1.12734 WP_003433888.1.12807 WP_003433888.1.12953 WP_003433888.1.13273 WP_003433888.1.13418 WP_003433888.1.13730 WP_003433888.1.13841 WP_003433888.1.13859 WP_003433888.1.14045 WP_003433888.1.141 WP_003433888.1.14177 WP_003433888.1.1422 WP_003433888.1.14259 WP_003433888.1.14330 WP_003433888.1.14352 WP_003433888.1.14457 WP_003433888.1.14579 WP_003433888.1.14686 WP_003433888.1.14698 WP_003433888.1.14848 WP_003433888.1.1494 WP_003433888.1.15083 WP_003433888.1.15097 WP_003433888.1.15192 WP_003433888.1.15205 WP_003433888.1.15435 WP_003433888.1.15908 WP_003433888.1.16012 WP_003433888.1.16135 WP_003433888.1.16185 WP_003433888.1.16376 WP_003433888.1.169 WP_003433888.1.16966 WP_003433888.1.1705 WP_003433888.1.17371 WP_003433888.1.17413 WP_003433888.1.17463 WP_003433888.1.17512 WP_003433888.1.17611 WP_003433888.1.17638 WP_003433888.1.17808 WP_003433888.1.17960 WP_003433888.1.18060 WP_003433888.1.18207 WP_003433888.1.1838 WP_003433888.1.18407 WP_003433888.1.18462 WP_003433888.1.18551 WP_003433888.1.18805 WP_003433888.1.19088 WP_003433888.1.1926 WP_003433888.1.19290 WP_003433888.1.1934 WP_003433888.1.19648 WP_003433888.1.19704 WP_003433888.1.19956 WP_003433888.1.1999 WP_003433888.1.2002 WP_003433888.1.20184 WP_003433888.1.20302 WP_003433888.1.20313 WP_003433888.1.20481 WP_003433888.1.20728 WP_003433888.1.20872 WP_003433888.1.20960 WP_003433888.1.21000 WP_003433888.1.21048 WP_003433888.1.21201 WP_003433888.1.21417 WP_003433888.1.21520 WP_003433888.1.21547 WP_003433888.1.21704 WP_003433888.1.21893 WP_003433888.1.22079 WP_003433888.1.22128 WP_003433888.1.22228 WP_003433888.1.22313 WP_003433888.1.22411 WP_003433888.1.22417 WP_003433888.1.22568 WP_003433888.1.22569 WP_003433888.1.22615 WP_003433888.1.22768 WP_003433888.1.22893 WP_003433888.1.23096 WP_003433888.1.23208 WP_003433888.1.23287 WP_003433888.1.23338 WP_003433888.1.24197 WP_003433888.1.24457 WP_003433888.1.24520 WP_003433888.1.24889 WP_003433888.1.24900 WP_003433888.1.24987 WP_003433888.1.25128 WP_003433888.1.25416 WP_003433888.1.25761 WP_003433888.1.26024 WP_003433888.1.26358 WP_003433888.1.26482 WP_003433888.1.26494 WP_003433888.1.26697 WP_003433888.1.26940 WP_003433888.1.2758 WP_003433888.1.27708 WP_003433888.1.27824 WP_003433888.1.27872 WP_003433888.1.27881 WP_003433888.1.27890 WP_003433888.1.27967 WP_003433888.1.27996 WP_003433888.1.28055 WP_003433888.1.28410 WP_003433888.1.28638 WP_003433888.1.28715 WP_003433888.1.28856 WP_003433888.1.28882 WP_003433888.1.28890 WP_003433888.1.28930 WP_003433888.1.293 WP_003433888.1.29891 WP_003433888.1.3024 WP_003433888.1.3031 WP_003433888.1.30420 WP_003433888.1.30431 WP_003433888.1.30463 WP_003433888.1.30521 WP_003433888.1.30743 WP_003433888.1.30841 WP_003433888.1.30953 WP_003433888.1.31203 WP_003433888.1.31292 WP_003433888.1.31309 WP_003433888.1.31453 WP_003433888.1.31477 WP_003433888.1.31519 WP_003433888.1.31637 WP_003433888.1.31969 WP_003433888.1.32008 WP_003433888.1.32066 WP_003433888.1.32166 WP_003433888.1.32197 WP_003433888.1.32218 WP_003433888.1.32294 WP_003433888.1.32769 WP_003433888.1.32776 WP_003433888.1.32842 WP_003433888.1.33056 WP_003433888.1.33098 WP_003433888.1.33164 WP_003433888.1.33298 WP_003433888.1.33332 WP_003433888.1.33349 WP_003433888.1.3340 WP_003433888.1.33514 WP_003433888.1.33810 WP_003433888.1.34388 WP_003433888.1.34489 WP_003433888.1.34545 WP_003433888.1.34641 WP_003433888.1.34800 WP_003433888.1.34985 WP_003433888.1.35 WP_003433888.1.35002 WP_003433888.1.35137 WP_003433888.1.35187 WP_003433888.1.35234 WP_003433888.1.3559 WP_003433888.1.35832 WP_003433888.1.35884 WP_003433888.1.36078 WP_003433888.1.36257 WP_003433888.1.36738 WP_003433888.1.36835 WP_003433888.1.37255 WP_003433888.1.374 WP_003433888.1.37493 WP_003433888.1.37532 WP_003433888.1.37597 WP_003433888.1.37861 WP_003433888.1.37957 WP_003433888.1.37981 WP_003433888.1.38305 WP_003433888.1.38338 WP_003433888.1.38692 WP_003433888.1.38775 WP_003433888.1.38814 WP_003433888.1.38874 WP_003433888.1.38924 WP_003433888.1.38986 WP_003433888.1.39008 WP_003433888.1.3913 WP_003433888.1.39213 WP_003433888.1.39350 WP_003433888.1.39382 WP_003433888.1.39442 WP_003433888.1.39621 WP_003433888.1.39783 WP_003433888.1.39874 WP_003433888.1.40030 WP_003433888.1.40294 WP_003433888.1.40313 WP_003433888.1.40447 WP_003433888.1.40557 WP_003433888.1.407 WP_003433888.1.40775 WP_003433888.1.40891 WP_003433888.1.40959 WP_003433888.1.40966 WP_003433888.1.41131 WP_003433888.1.4121 WP_003433888.1.4137 WP_003433888.1.41506 WP_003433888.1.41641 WP_003433888.1.41687 WP_003433888.1.41818 WP_003433888.1.41995 WP_003433888.1.42035 WP_003433888.1.4204 WP_003433888.1.42066 WP_003433888.1.42533 WP_003433888.1.42610 WP_003433888.1.43112 WP_003433888.1.4315 WP_003433888.1.4321 WP_003433888.1.43388 WP_003433888.1.43490 WP_003433888.1.43519 WP_003433888.1.43579 WP_003433888.1.43663 WP_003433888.1.43824 WP_003433888.1.4383 WP_003433888.1.44030 WP_003433888.1.44105 WP_003433888.1.44149 WP_003433888.1.44198 WP_003433888.1.44241 WP_003433888.1.44470 WP_003433888.1.44729 WP_003433888.1.45017 WP_003433888.1.45059 WP_003433888.1.45142 WP_003433888.1.45209 WP_003433888.1.45352 WP_003433888.1.45554 WP_003433888.1.4573 WP_003433888.1.45938 WP_003433888.1.45986 WP_003433888.1.46274 WP_003433888.1.46280 WP_003433888.1.46305 WP_003433888.1.4698 WP_003433888.1.47016 WP_003433888.1.47173 WP_003433888.1.47227 WP_003433888.1.47228 WP_003433888.1.47479 WP_003433888.1.47615 WP_003433888.1.47708 WP_003433888.1.47729 WP_003433888.1.47940 WP_003433888.1.48246 WP_003433888.1.4835 WP_003433888.1.48746 WP_003433888.1.48772 WP_003433888.1.48983 WP_003433888.1.48991 WP_003433888.1.49020 WP_003433888.1.49054 WP_003433888.1.49065 WP_003433888.1.4908 WP_003433888.1.49092 WP_003433888.1.49230 WP_003433888.1.49310 WP_003433888.1.49339 WP_003433888.1.4948 WP_003433888.1.49633 WP_003433888.1.50159 WP_003433888.1.50341 WP_003433888.1.50460 WP_003433888.1.5073 WP_003433888.1.50865 WP_003433888.1.51007 WP_003433888.1.51235 WP_003433888.1.51675 WP_003433888.1.5187 WP_003433888.1.51996 WP_003433888.1.52073 WP_003433888.1.52266 WP_003433888.1.52278 WP_003433888.1.52311 WP_003433888.1.52330 WP_003433888.1.52383 WP_003433888.1.52466 WP_003433888.1.52525 WP_003433888.1.52789 WP_003433888.1.52958 WP_003433888.1.52997 WP_003433888.1.53008 WP_003433888.1.53055 WP_003433888.1.5337 WP_003433888.1.53504 WP_003433888.1.53987 WP_003433888.1.54058 WP_003433888.1.54153 WP_003433888.1.54350 WP_003433888.1.54586 WP_003433888.1.55055 WP_003433888.1.55101 WP_003433888.1.5521 WP_003433888.1.55302 WP_003433888.1.55371 WP_003433888.1.55391 WP_003433888.1.559 WP_003433888.1.56006 WP_003433888.1.56217 WP_003433888.1.56252 WP_003433888.1.56323 WP_003433888.1.56337 WP_003433888.1.56556 WP_003433888.1.5657 WP_003433888.1.5661 WP_003433888.1.5664 WP_003433888.1.56664 WP_003433888.1.56711 WP_003433888.1.56754 WP_003433888.1.56927 WP_003433888.1.56998 WP_003433888.1.5750 WP_003433888.1.58015 WP_003433888.1.58216 WP_003433888.1.58304 WP_003433888.1.58315 WP_003433888.1.58463 WP_003433888.1.58531 WP_003433888.1.58665 WP_003433888.1.58677 WP_003433888.1.58818 WP_003433888.1.58956 WP_003433888.1.59032 WP_003433888.1.5905 WP_003433888.1.59618 WP_003433888.1.59628 WP_003433888.1.59752 WP_003433888.1.59990 WP_003433888.1.6031 WP_003433888.1.60482 WP_003433888.1.60563 WP_003433888.1.6070 WP_003433888.1.60957 WP_003433888.1.60998 WP_003433888.1.61042 WP_003433888.1.61140 WP_003433888.1.61293 WP_003433888.1.61716 WP_003433888.1.61866 WP_003433888.1.62049 WP_003433888.1.62095 WP_003433888.1.62128 WP_003433888.1.62577 WP_003433888.1.62624 WP_003433888.1.62941 WP_003433888.1.62986 WP_003433888.1.63020 WP_003433888.1.63059 WP_003433888.1.63239 WP_003433888.1.63343 WP_003433888.1.63378 WP_003433888.1.63516 WP_003433888.1.63570 WP_003433888.1.63598 WP_003433888.1.63696 WP_003433888.1.64020 WP_003433888.1.64092 WP_003433888.1.64369 WP_003433888.1.64546 WP_003433888.1.64573 WP_003433888.1.64859 WP_003433888.1.65064 WP_003433888.1.65067 WP_003433888.1.65369 WP_003433888.1.65889 WP_003433888.1.66084 WP_003433888.1.66237 WP_003433888.1.66439 WP_003433888.1.66474 WP_003433888.1.66565 WP_003433888.1.66587 WP_003433888.1.66608 WP_003433888.1.66643 WP_003433888.1.66701 WP_003433888.1.6671 WP_003433888.1.66805 WP_003433888.1.66847 WP_003433888.1.6685 WP_003433888.1.66887 WP_003433888.1.67303 WP_003433888.1.67308 WP_003433888.1.67368 WP_003433888.1.67689 WP_003433888.1.67711 WP_003433888.1.6792 WP_003433888.1.67951 WP_003433888.1.68150 WP_003433888.1.68322 WP_003433888.1.68980 WP_003433888.1.69114 WP_003433888.1.692 WP_003433888.1.69220 WP_003433888.1.69333 WP_003433888.1.69708 WP_003433888.1.6994 WP_003433888.1.70179 WP_003433888.1.70231 WP_003433888.1.70320 WP_003433888.1.70695 WP_003433888.1.70710 WP_003433888.1.70820 WP_003433888.1.70886 WP_003433888.1.71079 WP_003433888.1.71119 WP_003433888.1.713 WP_003433888.1.71384 WP_003433888.1.71477 WP_003433888.1.7156 WP_003433888.1.7199 WP_003433888.1.72113 WP_003433888.1.72245 WP_003433888.1.72468 WP_003433888.1.72483 WP_003433888.1.72560 WP_003433888.1.72891 WP_003433888.1.72914 WP_003433888.1.72994 WP_003433888.1.73026 WP_003433888.1.73116 WP_003433888.1.73852 WP_003433888.1.74126 WP_003433888.1.74672 WP_003433888.1.74678 WP_003433888.1.74835 WP_003433888.1.74897 WP_003433888.1.75026 WP_003433888.1.75210 WP_003433888.1.75226 WP_003433888.1.75287 WP_003433888.1.75454 WP_003433888.1.75638 WP_003433888.1.75659 WP_003433888.1.76207 WP_003433888.1.76550 WP_003433888.1.76552 WP_003433888.1.76603 WP_003433888.1.76621 WP_003433888.1.76664 WP_003433888.1.76793 WP_003433888.1.76882 WP_003433888.1.7696 WP_003433888.1.77092 WP_003433888.1.77102 WP_003433888.1.77473 WP_003433888.1.77509 WP_003433888.1.77544 WP_003433888.1.77639 WP_003433888.1.77842 WP_003433888.1.77942 WP_003433888.1.78123 WP_003433888.1.78579 WP_003433888.1.78949 WP_003433888.1.7916 WP_003433888.1.79221 WP_003433888.1.79309 WP_003433888.1.79344 WP_003433888.1.79680 WP_003433888.1.79703 WP_003433888.1.79836 WP_003433888.1.80052 WP_003433888.1.80144 WP_003433888.1.80342 WP_003433888.1.80379 WP_003433888.1.80455 WP_003433888.1.80504 WP_003433888.1.80575 WP_003433888.1.80963 WP_003433888.1.81035 WP_003433888.1.81044 WP_003433888.1.81299 WP_003433888.1.81351 WP_003433888.1.81402 WP_003433888.1.81605 WP_003433888.1.81777 WP_003433888.1.82084 WP_003433888.1.82169 WP_003433888.1.82635 WP_003433888.1.82701 WP_003433888.1.82920 WP_003433888.1.8314 WP_003433888.1.83148 WP_003433888.1.83175 WP_003433888.1.83255 WP_003433888.1.83287 WP_003433888.1.83288 WP_003433888.1.83318 WP_003433888.1.83348 WP_003433888.1.834 WP_003433888.1.83477 WP_003433888.1.83822 WP_003433888.1.84253 WP_003433888.1.84528 WP_003433888.1.84646 WP_003433888.1.84923 WP_003433888.1.85020 WP_003433888.1.85127 WP_003433888.1.85214 WP_003433888.1.85219 WP_003433888.1.85420 WP_003433888.1.85442 WP_003433888.1.85454 WP_003433888.1.85776 WP_003433888.1.85863 WP_003433888.1.8587 WP_003433888.1.85874 WP_003433888.1.85932 WP_003433888.1.86008 WP_003433888.1.86011 WP_003433888.1.86049 WP_003433888.1.86088 WP_003433888.1.86094 WP_003433888.1.86116 WP_003433888.1.86117 WP_003433888.1.86743 WP_003433888.1.86767 WP_003433888.1.86837 WP_003433888.1.86914 WP_003433888.1.87195 WP_003433888.1.87326 WP_003433888.1.87714 WP_003433888.1.87723 WP_003433888.1.87918 WP_003433888.1.88091 WP_003433888.1.882 WP_003433888.1.88268 WP_003433888.1.88332 WP_003433888.1.88364 WP_003433888.1.88608 WP_003433888.1.88640 WP_003433888.1.88996 WP_003433888.1.89052 WP_003433888.1.89065 WP_003433888.1.89196 WP_003433888.1.89364 WP_003433888.1.89457 WP_003433888.1.89629 WP_003433888.1.89697 WP_003433888.1.89994 WP_003433888.1.90101 WP_003433888.1.90164 WP_003433888.1.90329 WP_003433888.1.90491 WP_003433888.1.90555 WP_003433888.1.90643 WP_003433888.1.9083 WP_003433888.1.90921 WP_003433888.1.90938 WP_003433888.1.90981 WP_003433888.1.91254 WP_003433888.1.91314 WP_003433888.1.91570 WP_003433888.1.91648 WP_003433888.1.92075 WP_003433888.1.92284 WP_003433888.1.92371 WP_003433888.1.92576 WP_003433888.1.92697 WP_003433888.1.93044 WP_003433888.1.93171 WP_003433888.1.93313 WP_003433888.1.93615 WP_003433888.1.93687 WP_003433888.1.93717 WP_003433888.1.93766 WP_003433888.1.93782 WP_003433888.1.93798 WP_003433888.1.93802 WP_003433888.1.93830 WP_003433888.1.9393 WP_003433888.1.94067 WP_003433888.1.94073 WP_003433888.1.94166 WP_003433888.1.94427 WP_003433888.1.94768 WP_003433888.1.94968 WP_003433888.1.95095 WP_003433888.1.95173 WP_003433888.1.95350 WP_003433888.1.95517 WP_003433888.1.9580 WP_003433888.1.95847 WP_003433888.1.95893 WP_003433888.1.96113 WP_003433888.1.9635 WP_003433888.1.96503 WP_003433888.1.96505 WP_003433888.1.9666 WP_003433888.1.96690 WP_003433888.1.97219 WP_003433888.1.97458 WP_003433888.1.97672 WP_003433888.1.97682 WP_003433888.1.97806 WP_003433888.1.98037 WP_003433888.1.98514 WP_003433888.1.98698 WP_003433888.1.98715 WP_003433888.1.98856 WP_003433888.1.98997 WP_003433888.1.99064 WP_003433888.1.99134 WP_003433888.1.99333 WP_003433888.1.99542 WP_003433888.1.99545 WP_003433888.1.9986 YP_001088710.1.32744 272563.CD2197 gi|126699813|ref|YP_001088710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]