SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034TAK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034TAK6
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily MtlR-like 1.57e-53
Family MtlR-like 0.0000000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034TAK6
Sequence length 176
Comment (tr|A0A034TAK6|A0A034TAK6_9VIBR) Mannitol operon repressor {ECO:0000313|EMBL:GAJ69801.1} KW=Complete proteome OX=1298599 OS=Vibrio sp. JCM 18904. GN=JCM18904_472 OC=Vibrionaceae; Vibrio.
Sequence
MADNINETEIIERLNSAPSVRGFFIAAVDVFNDSIDGWCKESFVKINFAVQSVVGPLLQD
SGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNQLNSDASDYEFTDPNILEPIKKLH
LVKKMGMVQLEVSEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELSKDSPF
Download sequence
Identical sequences A0A034TAK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]