SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A034TCN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034TCN3
Domain Number 1 Region: 445-547
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000182
Family Anti-sigma factor antagonist SpoIIaa 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034TCN3
Sequence length 562
Comment (tr|A0A034TCN3|A0A034TCN3_9VIBR) Sulfate permease {ECO:0000313|EMBL:GAJ70843.1} KW=Complete proteome OX=1298599 OS=Vibrio sp. JCM 18904. GN=JCM18904_1573 OC=Vibrionaceae; Vibrio.
Sequence
MFGSRFEDINFKGGDVFGGGVTTAIISLPLALAFGVASGAGAEAGLWGAIMVGLFASLFG
GSNTLISEPTGPMTVIMTAVLTSMMAKYPETGMAMTFTVVMMAGAFQILLGTLKLGKYVT
LMPYSVISGFMSGIGVILIILQLSPLMGGHAAPSGGGVLGTLSALPETISNLKFSELFLG
LLTLGGILFFFPKQYRKYVPAQLVALVAVTLLSVILFDTEDIRRIGEIPAGLPSLVAPYI
DTDMFVEMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDKELRGQGLANMISGLFGAL
PGAGGYHGTVTNIQVGGARSPLSGVIRALMLALVVLVAGGLTEPIPMAVLAGIAVYVGFN
ILDWSFIQRAHKVSFSGMAVMYGVMLLTVFVDLIVAVGLGVFISNIIIIERLSREQARQV
KAISDADEDDVPLTDSERGLLDRANGKVLFFYLSGPMIFSVSKAISRQHSSISDYDVMIL
DLTDVPMIDVTVGLALENAIKDALDANCAVYLLCPNERTREQLEKFHVIDLVPDENMYQF
RYEALNAAVAHVEADQYQRITA
Download sequence
Identical sequences A0A034TCN3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]