SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034TFM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034TFM3
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.07e-19
Family Hypothetical zinc finger protein YacG 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034TFM3
Sequence length 65
Comment (tr|A0A034TFM3|A0A034TFM3_9VIBR) DNA gyrase inhibitor YacG {ECO:0000256|HAMAP-Rule:MF_00649, ECO:0000256|SAAS:SAAS00085446} KW=Complete proteome OX=1298599 OS=Vibrio sp. JCM 18904. GN=JCM18904_1557 OC=Vibrionaceae; Vibrio.
Sequence
MSKVTIVQCPQCGADVEWGGEQSPHRPFCSKQCQMIDFGEWADEENTIPGAPDMSDSDGW
SEDQY
Download sequence
Identical sequences A0A034TFM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]