SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034UHQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034UHQ8
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily ITPase-like 9.42e-62
Family ITPase (Ham1) 0.00000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034UHQ8
Sequence length 198
Comment (tr|A0A034UHQ8|A0A034UHQ8_9NOCA) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome OX=1206724 OS=Nocardia brasiliensis NBRC 14402. GN=NBRGN_081_00360 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MLVASRNAKKLNELRRILAEAGIAGIEIVGLDDVPAYDEAPETGATFEENALAKARDGAA
ATGLACVADDSGIEVDALNGMPGVLSARWAGKHGDDAANNALLLAQLGDVPDERRGARFV
STCALVVPDGAELVVRGEWPGTVGRKPLGEGGFGYDPLFFPDGGDLSAAQLTPAQKDAVS
HRGRALTQLLPALTELAD
Download sequence
Identical sequences A0A034UHQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]