SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A034VAR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VAR5
Domain Number 1 Region: 105-301
Classification Level Classification E-value
Superfamily MIR domain 1.13e-58
Family MIR domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 302-472
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.09e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000797
Further Details:      
 
Domain Number 3 Region: 4-84
Classification Level Classification E-value
Superfamily MIR domain 0.0000196
Family MIR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A034VAR5
Sequence length 836
Comment (tr|A0A034VAR5|A0A034VAR5_BACDO) Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:JAC38870.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=ITPR OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MNKRLPSLLEKNAMRVYLDANGNEGSWFYIMPFYKLRSAGDNVVVGDKVILNPVNAEQQN
LHVASNYELPDNPGCKEVNVLNSSTSWKITLFMEHKENQEHILKGGDVVRLFHAEQEKFL
TMDEYKKQQHVFLRTTGRTSATAATSSKALWEVEVVQHDSCRGGAGHWNSLYRFKHLATG
YYLAAELESVGSTTLIHSLDGNGLDTSLKESEKSKCERYRLVPVPYSTEIASVFELDPTT
MARADSLVPQSSYVRLRHLCSNTWVHATSIPIDIDDDKPVMSKVCCSPIKEDKEAFALIP
VSPVEVRDLDFANDACKVLDTVTSKLVNGSISINERRSLIALLQDIVFFIAGMENEQNKA
KALELTIKNPIRDRQKLLREQYILKQLFKILQGPFQEHPSGEAPFLRLDELSDPKNSPYK
NIFRLCYRILRLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRKLLEKHI
TAAEIETFVGLVRKNMLNWDSRFLDYLSDLCVSNRKAIAVTQELICKSVLSSKNSDILIE
TQIKHFKAPMGDVYRSAAEDSYSLSTLTEVLDDEEKSDLISNSTTTTSWDTTSLNDAPEI
EEKYEIHLKWRGQPNSRSMGDLADCAAQGKEEEAAILNYYRHQLNLFSNMCLNRQYLALN
ILSPHLDIDLILKCMSDETMPYELRASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSK
MSILDYDGKNQQPDQNKEAVRAKFNTTIAFVENYLCNVATKVWLFTDQEQNKLTFEVVKL
ARDLIYFGFYSFSDLLRLTKTLLCILDCVSETGMDGATPGRFVNTDIDCAIACVRQ
Download sequence
Identical sequences A0A034VAR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]