SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A034VH27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034VH27
Domain Number 1 Region: 95-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.02e-20
Family LIM domain 0.012
Further Details:      
 
Domain Number 2 Region: 32-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.18e-16
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 4-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000025
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A034VH27
Sequence length 177
Comment (tr|A0A034VH27|A0A034VH27_BACDO) Transforming growth factor beta-1-induced transcript 1 protein {ECO:0000313|EMBL:JAC41080.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=TGFI1 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MSESVCHKCNEVITKRIITALGKTWHPEHFACKDCNTPIEEATFNIQDGEPVCSKCFLKN
YSGTCHGCKQPILERTIKALGQTWHEDCFVCGGPCQKPLVGTSFYERDGRAYCKTDFEEL
FAARCAGCAKPITENAIVALNSKWHRDCFKCKKCANPITASIFAVEENKPVCTECSA
Download sequence
Identical sequences A0A034VH27
XP_011205099.1.45957 XP_019846303.1.45957 XP_019846304.1.45957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]