SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A034W195 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A034W195
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 1.7e-39
Family MIR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000259
Family SPRY domain 0.059
Further Details:      
 
Domain Number 3 Region: 1080-1141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000406
Family SPRY domain 0.033
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.0000000366
Family MIR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A034W195
Sequence length 1161
Comment (tr|A0A034W195|A0A034W195_BACDO) Ryanodine receptor 44F {ECO:0000313|EMBL:JAC48454.1} OX=27457 OS=Bactrocera dorsalis (Oriental fruit fly) (Dacus dorsalis). GN=RY44 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTASGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRVKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVVYEGGSVMSQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNENNELVL
VKKEEASIASTTFCLRQEKDDEKKVLEDKDLEVIGVPIIKYGDTTVIVQHCESSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFINALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINVITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASIRPNIFVGQVDGS
AMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAHLWTGGRRTLVVNDLPQEPYIRKGDVIGVTIDLSIPIITFSFNGSKVRGCFKDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKFTPPLGFSPLVQCLMPHQNLSLDPCFYFGNLNKN
VLAGPWLIEDDTAFVPNPVDTSGVALPSSVDHIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYQRIHPCLTHFEKLPLPERRYDSQLAVQTLKTIIALGYYITMDKPPARIRPIRLPNEI
FMQANGYKPAPLDLSAVTLSPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRS
PHLVPYSKVDEAIKKANRDTASETVRTLLVYGYILDPPTGEGNEGLLAEAQRLKFAAFRT
YRVERNYAVTTGKWYFEFEVLTAGPMRVGWARADCHPGTMLGSDDSSWAFDGHNVSFSGS
KNLIPQVDQPKLYTHMYIYEY
Download sequence
Identical sequences A0A034W195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]