SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A037Z618 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A037Z618
Domain Number 1 Region: 21-194
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.4e-27
Family Hypothetical protein TM0269 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A037Z618
Sequence length 226
Comment (tr|A0A037Z618|A0A037Z618_CLOTT) Uncharacterized protein {ECO:0000313|EMBL:KAJ51053.1} KW=Complete proteome; Reference proteome OX=1230342 OS=Clostridium tetanomorphum DSM 665. GN=CTM_15018 OC=Clostridium.
Sequence
MEKYSFNISKEEVLRYLGVKGSIEDNITSLIYDCTEELKKIIRFKVTYKVFTMKTEKEEV
LLRNCKLKLKGESIINHLKYCNDCVLFAATLGGEVDKKINYYERISMSKAIILDACATVA
IEEGCDFVEDEIRKIAIEQGKEITFRFSPGYGDLDLSIQESFIQTVEAYKNIGLTVSAHN
ILIPRKSVTAIIGFTPKDKKKEKKSCIRCNRYSNCQFKKVGEVCEF
Download sequence
Identical sequences A0A037Z618
WP_035149456.1.72967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]