SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A037ZN30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A037ZN30
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-21
Family Anti-sigma factor antagonist SpoIIaa 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A037ZN30
Sequence length 114
Comment (tr|A0A037ZN30|A0A037ZN30_9RHOB) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1454373 OS=Actibacterium mucosum KCTC 23349. GN=ACMU_02975 OC=Rhodobacteraceae; Actibacterium.
Sequence
MDLRVEDRGEALLVTVKQERIDAACAIQFKDRVREAVATDHERVVMDMSCVRFLDSSGLG
AVVAAMKLLGPERKLELASLTPAVAKVFRLTRMESVFKLHKTVDEAFGKDASAA
Download sequence
Identical sequences A0A037ZN30
WP_035255852.1.98761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]