SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A038GUT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A038GUT2
Domain Number 1 Region: 739-982
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.15e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 2 Region: 26-215
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.88e-19
Family PFOR Pyr module 0.084
Further Details:      
 
Domain Number 3 Region: 455-642
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.07e-16
Family Pyruvate oxidase and decarboxylase PP module 0.063
Further Details:      
 
Domain Number 4 Region: 274-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000942
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A038GUT2
Sequence length 1178
Comment (tr|A0A038GUT2|A0A038GUT2_9BURK) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KAK45720.1} KW=Complete proteome OX=1458357 OS=Caballeronia jiangsuensis. GN=BG58_16155 OC=Burkholderiaceae; Caballeronia.
Sequence
MNAPDRAALEAATISLDDKYTLEKGRVYISGTQALVRLPMLQKARDRKAGLNTAGFISGY
RGSPLGALDQSLWKAKQHLKDNDIVFQPGVNEDLAATSIWGTQQVNLWPGATRDGVFGMW
YGKGPGVDRTGDVFKHANSAGSDKHGGVLVLAGDDHAAKSSSVAHQSDHAFIAAGIPVLY
PSNVQEYLDYGLHGWAMSRYSGLWVAMKCVTDVVESTASIDLDPDRVEIVTPTDYAMPEG
GLNIRWPDSPLAQEARLLDEKWYAALAYVRANKLNRVVIDSDKPRFGIITAGKAYLDVRQ
ALVDLGLDDETCAQIGLRVLKVGCVWPLDAQDARAFATGLEEILVVEEKRQILEYALKEE
LYNWREDVRPRIYGKFDERDNEGGEWSVPRGDWLLPAHYELSPALIAKAIARRLARADLP
ADVRARMLSRVETIEAKEREAIKPRVDVERKPWFCSGCPHNTSTRVPEGSRALAGIGCHY
MSMWMDRKTETFSQMGGEGVAWIGQMHFSGDKHVFVNLGDGTYFHSGLLAVRAAIAANAN
ITYKILYNDAVAMTGGQPVDGVLTVPQIAHQVCAEGAKRIVIVTDEPQKYDANVALPQGV
SVHHRDELDRIQRELRDTQGTTILIYDQTCATEKRRRRKRGTYPDPARRAFINDAVCEGC
GDCSVQSNCLSVEPMDTPLGTKRKINQSSCNKDFSCVKGFCPSFVTAEGAQVRKPKAAGG
AKPDFDSLPLPALPALSKPYGILVTGVGGTGVVTIGGLIGMAAHIERKGVTVLDMAGLAQ
KGGAVLSHVQIAPEPQALHATRIATGEARLVIGCDAIVSASNDVLSRTRHGITQAAINSG
ATPTAAFVTDAQWTFPAAQTEQALSDSIGAGCAFIDANALALKLLGDTIYSNPLLLGFAW
QKGWLPLELASLKRAIELNGVAVEKNWLAFDWGRYVAQHGAGDLLKSTQHAIVVKMPESL
ENVIATREALLTSYQGEAYARSYRSVVERMREKEKALNAKLPLTRAVAVNLAKLMAYKDE
YEVARLYADPAYLDKLRAQFEGEPGRDYKLMFHLAPPLFAKRDEHGHLVKKTFGAWMLPA
FRVLAKMKGLRGTSLDIFGKTAERRTERKMIADYLALVDEFCATLDEDRFDAALQLAKLP
DEIRGFGHVKERNMAAVATKRERLIERYRATVKMAATA
Download sequence
Identical sequences A0A038GUT2
WP_035504008.1.68449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]