SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044U6P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044U6P9
Domain Number 1 Region: 38-94
Classification Level Classification E-value
Superfamily BPTI-like 4.4e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 2 Region: 133-187
Classification Level Classification E-value
Superfamily BPTI-like 7.52e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 3 Region: 189-243
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A044U6P9
Sequence length 249
Comment (tr|A0A044U6P9|A0A044U6P9_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC6318} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MSVSASGIQPLPAVQRNELMPVMLPKSGSFGVPALGRSRDACNERMDVGRCNGAFQSYYF
ERATGTCEPFRYSGCGGNANRFQTKEQCEELCVNRVSGVKTTGTLPPSIPESTFKHLLPI
SDDKIPHTSESVSKCELPKDTGPCNRFVTKWYYNKNDGTCTRFHYGGCDGTDNRFDSEQQ
CKNECGNFTDPCKLPKVSGPCSGKHKRYYFNRNTSRCERFEYGGCLGNSNNFLQLADCEM
KCLSSEERE
Download sequence
Identical sequences A0A044U6P9
OVOC6318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]