SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A044V2R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044V2R7
Domain Number 1 Region: 1011-1143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-22
Family SPRY domain 0.021
Further Details:      
 
Domain Number 2 Region: 197-325
Classification Level Classification E-value
Superfamily MIR domain 1.83e-16
Family MIR domain 0.0053
Further Details:      
 
Domain Number 3 Region: 595-731
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000554
Family SPRY domain 0.078
Further Details:      
 
Domain Number 4 Region: 4150-4227
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000466
Family Calmodulin-like 0.054
Further Details:      
 
Weak hits

Sequence:  A0A044V2R7
Domain Number - Region: 2182-2270
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000103
Family IP3 receptor type 1 binding core, domain 2 0.021
Further Details:      
 
Domain Number - Region: 319-533
Classification Level Classification E-value
Superfamily ARM repeat 0.00279
Family MIF4G domain-like 0.068
Further Details:      
 
Domain Number - Region: 101-161
Classification Level Classification E-value
Superfamily MIR domain 0.00785
Family MIR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A044V2R7
Sequence length 5043
Comment (tr|A0A044V2R7|A0A044V2R7_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC8464} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MTDKDGTGDGEQDDISFLRTGDIIAMTCLASANREGVLGSERVCLCTEGFGNRMCSLENV
SDRDLPPDISMCMLYIYNALSVRALQEMMSNDNELYLACLSSCSSNDKLAFDVGVQENNE
GEACWWTIHPASKQRSEGEKVRVGDDVILVSVATERYLHMIHGKGFMVIASFHQTLWNIT
SVSSGSIRIRNMGALFGNDILRFFHGNDEVLTIPENWSEHPQHNMAIYEGGAAVSQARSL
WRIELIRFKWHGALDLKKQLIEEKEEGMGVATIYYGETIAFIQHIKTELWLSYQTSEITK
KGLGKVEEKKAVALKDGHMDDCFTFFMALEEESKSARVIRKCSSVLNRFLKGIEALQREG
KQAQDWNRVDLNEVLKLMEDLIDYFAQPEEDDFEVSQNRLRALRSRQDLFQEEGVLNMIL
DTIDKFSQMEAVPDFAALLNEDTQFVWEEISTYLYLLVAAMIKGNHYNCAQFASAQRLQW
LFGRLSNPQSAEGILDVLYCVLTESPEALNMINESHIKSVISLLEKVGRDPKVLDVLSSL
CEGNGMAVRSSQNTITQHLLPGKDLLLQTKMRDHVSSMTPNILVGVVEGSSQFRRWYYEA
EVEHIEQMTNTKPYLRIGWANSMGYKPFPGSGDGWGCIGIGDDYYSYGFDGQCIYCGRLF
INTTKKHVVWTRTLQKGDVVGCLLDLNIPEISFTVNGHSTAGLFKNFNIDGFFFPVMSLS
AKVSCRFMFGGTEGRLRFGPPPGFSPLIEAVVNQLEIGECLSFGDIAKNVYTGPSILRQN
TEPFVPVLVDISNVVLPEFAMEIHEKLAENLHELWAMRKTELGWSYGEVRDEKTRRHPCL
TSFQQLPQNEKTYNINLAIDTMKTIEALRYHMILDEPAVRMRHLHLPQNYQQSNGFKPQP
LDSHEIILDDNVFPLIDALAKNTHNVWAREKIRRGWTFGLNEFLNMNQKRTPHLVPYEVV
DQRIKEANRESATEFVKVLQLFGIFLEPPVLEHDEGAEKELKATQALSRTYRAEATYAVS
SGKWYFEFEVLTSGFMKVGWMDVSASSTFDIGKDDRSYGFDGYLARKWHQGSGTYGREWK
IGDIVGAFLDLSDHTISFSLNGELLLDPSGSEMAFDNVLVTDGFVPAMTFSTGQKARLNF
GQDSNSLKYFTTCGLQEGYEPFCVNMYRQMPMWYAKRLPQFEDIGLNSTMEISRIPATGN
SPPCLKITQKQINTGDITVQEKAKMEYIRLSLPVKCNDKLQQTKDKESIMRSVQEIEKQH
LAEEVQSVTMIRHPAIPREFGDDTKKKLGRSLLSAFKHSTEEDENLARSKPISFESDQLL
EPSTIRMSGSMLELSSHDEHRVVKHKRGGLMAKLHQRKNEIKRTLADGHTVNADAISAES
MPPSILKDDQDMPRSGPGRYRRLMSGKSKKNKLEKQAFVENRRPSIAALDQSVTVEGSVP
SDDMRAMIELSDKIDEFYYAIRIFPGQDPANVWVGWVTPKYHFYAERFITGEAVRICKYQ
EMNKNVNEGESLEYRNCYIINAAELLQSVSDAGNTKVSGLSIGCIIDTSIGELSFLVSNQ
DTGFRFKLEPGAILYPAAFVAPTSAEVLQFELGRIKYTFPLSSAMFKSSHKSLLPFCPPR
LTVEKLNPVHWARVPNECLRTTALKLSESRGWSVLCDDPVRIMSIYVPEKDTSYDILEMI
ERNDFLVFHRQTLNLYCKLAAHGNQKVAHILCSHVDEDQIMYAVKSHYFSGPLRQGFHDF
LIAVHLRTYVDARQSTSHEYVIPLTQSLEIKNVFQTENENRFPQILGPTISIRPVTVRSE
VCRDSGTDAESKLLPPAFNFTALKTHVMSALSSATEHAVINCRDLIGGNCLNHFEPLFKL
FNSLLVIGIFDDDDMKDVLKLIHPIAFDENYVPGSKQKGFTEIELAEGVKIQLTMILENI
CDVQLRHRVESLISFAAGFVGDLQQDQFSRYMSIKQTDMSPAEAARRTKEFRCPPREQMF
RLMKCKAVSDDSVGIMLDDETEYDQCPMDEKLQQQLREFCSLLVSKIGCIKNEERNELSE
LEVLEEANSWVDQLAQLVIRVPPPLPGEDNSMNHNGTENFRHMICKMLKSWATSSMIESN
ELIRKMFSLLLRQYTGITEMMKALSQTYVLHERNIEDVQDFIENLVQVRELVSVQFQSTE
EAVLKRGLWKLMNNRIFFQHPDLMRLLTVHENVMSIMMNVLTAQQGAADHGEHAEHIEST
ENIAHAQESKNASEMVVACSRFLCYFCRTSRHNQKAMFEHLSFLLDNATMLLARPSLRGS
VPLDIAYSSFMDNSELALALKEEELDKVTVYLSRCGLQPNLELIAKGYPDIGWDPVEGER
YIDFLRFCVWINGESVEANANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAIALSEDIR
ALEKDKNRAVIYSALLREQPHYPNKEAEGEDYVDLGAATLDFYSSLVDLLAKCAPDKINI
QAGKGDCVRARAILRSLISMDDLGQILALRFTIPNLIASTAIDDEPLPGLLPNHKQSVLL
FLDRVYGIDSQEMFFHFLEKSFLPDLRAATMMDSPCSLESDTALALNRYLCNAVLPLLTN
HSNYFANAEHHAALLDTTLHTVYSMNHLQSLTKNQRDAVSDFLVAITHELPPAMMVKFMR
KVITDIQEMNENLVVPLRILTLHYERCTKYYGLGNIYGMASEVEKRLSMLLFYAIFDSLG
SRPYDPELFGKALPCLTAIGSAISPDYTLTTTSDTKDKIQKTKDHGVWNPDPVDVSGIYF
DDDLVSVIAKFAEHFHDSWASRKIEKGWNYGELYSRQALTHPRLKPFAFLPDFEKNFYQE
RCAECLRALLVWNYSIELADRDAAERAAQNNISLDTSIENFNPRPVDLSNMTLEKDMIGI
AEKMAEESHKIWAKKIFADLSRGGNMPPQLVPWDLLTDFERRKDRFRAAEILKFLQYYGY
RVWSSNRIEPSAERVKIDSERSSVEKRFAYNLLKKLTQYLEQAFLKMKTIKPSQELTRQN
SFKKESQDVKFFEKVVLPLMHVYFNAHKNYFLASSSIVQTGMASDKEKEMVANLFCRLAS
LLRIKNHAFGSVAKITVRCLQGLTQALDLRTLVKINSDILRTGLLTFFNNCADDLFSAVE
EVQNGGQYSLLRGQNLKSWVSLEFANQVIIPILTTMFVHLAENHFGSDLLLDEIQAACYK
ILDSAYFMNNLAAATSQRKSIAYEMDKHRPALGQCLAAFASCFPVAFLEDKFNKSNKYSL
MAKSQEQSVQVQEMLQNLLAHIPQLDKLLADVEQMEQSGIMYRDQPAIYDVDLPLVCSYL
TYWWQFGPDSNNKSTVPITDVNNEYINRIFRALLQMIRNHIGVENASWLCRINFFSMQII
PYVSCDMVKDHMLPIAECLRCLAEKAYKEEEYMRTHPDDADEGTVAEDNAHLVRDVYAFF
PILMKYTDLHRAQWLKWPSWETDGIYENVAIIFKIWSLSQHFKREELNFMAQYEDESLAG
STGEMKTGKAAIAERKKKRREGQIRKDKHAGSIVIACLKRLLPVGLNVFGGRELDIVQQA
KEKFLAKESEEKIRELVRSLLDVPAKTDPTDKNAWQLNLYRKIGKSQMRNKNVMTLEGIV
EKITSMGQVVAILHVTEHPQGSMVNAWKTMLSSQRKRAVVACFRMIPLYGIPRYCIINVV
KQNFFFLLPTLSHIKIVCSWWIIICKSLRWNRNFLHCAQYVVVLPQATNKFKKESQWRRI
LTLQRKRLAISLITASHLYRTETHRAINFFLPALNKLWLEDEDVGQDALIKELTLADETQ
EQVHSKSGDEEILSDEKDEKFQASPDPLRQLIQCFQHAATSEQTQTISIANDSLFVNFAQ
VMSKSVHIEDEDEADENEGELDQAQKEEKSQALRAEQAVLADRGAAIMCLMYLSASNGEP
SDMVAEALQLGIHLLNGGNSKIQEMLIDYLQLKKDVRFFVSLAGLMNKCSVLNLEMYERQ
IKAEGLGMGAELASAANQNLNDSEFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNL
INCTVDYLLRLQESVMDFYWHYSSKDVIDESGKEYFLRAIHVCSQGPCTGNQMTLANSRL
WDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMV
DALVESEQNVEMILKFSDMFLKLKDLTTSQAFQDFDTNRDGWISPKEFQRAMESQKMYSV
EEITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNVAVLLTNLKEHITSDPRLEKIIK
QASSLLEYFDPFLGRIEIMGSSKKVEKIYFEIQESWLEQWSKQQIRDSKNSFLFNVLQDD
GGDQGKLEAFINFCEDTIFEMQHAAEISAGDVADSKIERAKKQRDYFLQQTSAGAQISAT
FKTGLNYGVNAANALKPANVKRIFNTANDTLKSMTWAQLIFAIVTLSVKSSVKVAMFIYL
IICTLFRFGYYLMTPDRDDLEVEQAALPMPESVDKQYASPVWPSFQQSNRSGNYDVFGVR
LPSTYAQTPTTPTGQSKSEVTNAPSPIQQSEAVLKPSTQQDPSFYETQTVSDGAHYNQVA
SPAVSEYGVANYYEPKIAEQISLRSRGSLLNMLARNFKAIEKTTLYLAFFINVILLFHRI
KITEDVTPADEDTESVYISGVVLPYTSYEITGWMLAQLLYWISVLHAVASFALLVSFYQL
KIPLITFKREKEVARRLMFDGCWLTEDDDEERSLTNTVFWYIDRIVISSKSFPMKYWDKF
VRRKTRQKFRDQIDDEILITVLGEDKSTTDTAFDYRYACWLWLGVILTNGQFLYRVHYLL
CSALGVLVSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVLAF
NFFRKFYVQESEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYWRMLY
DISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFE
IHTSKEHNFANYLFFLQHLVNKDKTEYTGQETYVREKYDNRDWEFFPVGECFMKQYEDQL
LQS
Download sequence
Identical sequences A0A044V2R7
OVOC8464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]