SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A044VID9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044VID9
Domain Number 1 Region: 6-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-90
Family Capz beta-1 subunit 0.00000000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A044VID9
Sequence length 270
Comment (tr|A0A044VID9|A0A044VID9_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC9911} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MKFEIQLDCALDLMRRLPPQQVERNLNDLIDLCPRLVDDLLSAVDQPLKIARDKETGKEY
LLCDYNRDGDSYRSPWSNTYDPPLEDGASPSDKLRKLEIEMNAAFEAYRDAYFEGGVSSV
YFWDLDYGFAGVVLIKKIGDGLRNIQGCWDSIHVIEIQEKAGGRHAHYKLTSTVMLWLQM
TKQASGMMNLGGSVTRQVEADHPVNDSTNTHLINIGKMIEDLESKIRSTLNEVYFGKTKQ
IVGELRTTLDSEELKRQKKIATEIKGGIGK
Download sequence
Identical sequences A0A044VID9
OVOC9911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]