SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A045IZI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A045IZI1
Domain Number 1 Region: 446-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A045IZI1
Sequence length 560
Comment (tr|A0A045IZI1|A0A045IZI1_MYCTX) Sulfate ABC transporter {ECO:0000313|EMBL:COW22893.1} KW=Complete proteome OX=1773 OS=Mycobacterium tuberculosis. GN=ERS007741_01886 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAVLTVAAYLIPQAMAYATVAGLPPAAGLWA
SIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGDLRRYAVLAATLGLLVGLICL
LAGTARLGFLASLLSRPVLVGYMAGIALVMISSQLGTITGTSVEGNEFFSEVHSFATSVT
RVHWPTFVLAMSVLALLTMLTRWAPRAPGPIIAVLAATMLVAVMSLDAKGIAIVGRIPSG
LPTPGVPPVSVEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACN
IAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLLAMFPIAALGA
LVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLGVFYGVLAAVALSILELLRRV
AHPHDSVLGFVPGIAGMHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQD
PGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDK
IGEDHIFMTLPTAVQAFRRR
Download sequence
Identical sequences A0A045IZI1
gi|506926221|ref|YP_008006671.1| WP_003901239.1.100069 WP_003901239.1.100208 WP_003901239.1.100216 WP_003901239.1.100255 WP_003901239.1.100308 WP_003901239.1.100383 WP_003901239.1.100460 WP_003901239.1.100697 WP_003901239.1.100703 WP_003901239.1.100716 WP_003901239.1.100722 WP_003901239.1.100754 WP_003901239.1.1008 WP_003901239.1.100866 WP_003901239.1.100889 WP_003901239.1.100915 WP_003901239.1.100984 WP_003901239.1.100998 WP_003901239.1.10116 WP_003901239.1.101209 WP_003901239.1.101350 WP_003901239.1.10144 WP_003901239.1.101442 WP_003901239.1.101553 WP_003901239.1.101573 WP_003901239.1.10159 WP_003901239.1.101592 WP_003901239.1.101607 WP_003901239.1.101687 WP_003901239.1.101698 WP_003901239.1.101743 WP_003901239.1.101764 WP_003901239.1.101797 WP_003901239.1.101802 WP_003901239.1.101899 WP_003901239.1.102 WP_003901239.1.102017 WP_003901239.1.102053 WP_003901239.1.102063 WP_003901239.1.102119 WP_003901239.1.102121 WP_003901239.1.10262 WP_003901239.1.10277 WP_003901239.1.10396 WP_003901239.1.10430 WP_003901239.1.105 WP_003901239.1.10545 WP_003901239.1.1057 WP_003901239.1.10643 WP_003901239.1.10756 WP_003901239.1.10825 WP_003901239.1.10879 WP_003901239.1.1095 WP_003901239.1.10956 WP_003901239.1.10980 WP_003901239.1.1100 WP_003901239.1.11040 WP_003901239.1.11175 WP_003901239.1.11222 WP_003901239.1.11373 WP_003901239.1.11761 WP_003901239.1.11826 WP_003901239.1.11898 WP_003901239.1.11972 WP_003901239.1.12052 WP_003901239.1.12116 WP_003901239.1.12190 WP_003901239.1.12294 WP_003901239.1.1231 WP_003901239.1.1236 WP_003901239.1.1255 WP_003901239.1.12550 WP_003901239.1.12692 WP_003901239.1.1271 WP_003901239.1.1279 WP_003901239.1.12804 WP_003901239.1.12947 WP_003901239.1.12957 WP_003901239.1.13043 WP_003901239.1.13090 WP_003901239.1.13096 WP_003901239.1.13175 WP_003901239.1.13183 WP_003901239.1.132 WP_003901239.1.13284 WP_003901239.1.13306 WP_003901239.1.13461 WP_003901239.1.13564 WP_003901239.1.13647 WP_003901239.1.13697 WP_003901239.1.13834 WP_003901239.1.13866 WP_003901239.1.13919 WP_003901239.1.13920 WP_003901239.1.13988 WP_003901239.1.14046 WP_003901239.1.14158 WP_003901239.1.14178 WP_003901239.1.14208 WP_003901239.1.14266 WP_003901239.1.14303 WP_003901239.1.14416 WP_003901239.1.14477 WP_003901239.1.14504 WP_003901239.1.14514 WP_003901239.1.1454 WP_003901239.1.14548 WP_003901239.1.1462 WP_003901239.1.14667 WP_003901239.1.14926 WP_003901239.1.14951 WP_003901239.1.15028 WP_003901239.1.15052 WP_003901239.1.15072 WP_003901239.1.15168 WP_003901239.1.15210 WP_003901239.1.15216 WP_003901239.1.15232 WP_003901239.1.15238 WP_003901239.1.15299 WP_003901239.1.1534 WP_003901239.1.15365 WP_003901239.1.15387 WP_003901239.1.15449 WP_003901239.1.15481 WP_003901239.1.15492 WP_003901239.1.15512 WP_003901239.1.15611 WP_003901239.1.15688 WP_003901239.1.15834 WP_003901239.1.15842 WP_003901239.1.15853 WP_003901239.1.15946 WP_003901239.1.15987 WP_003901239.1.15993 WP_003901239.1.16025 WP_003901239.1.16069 WP_003901239.1.16106 WP_003901239.1.16143 WP_003901239.1.16341 WP_003901239.1.16345 WP_003901239.1.164 WP_003901239.1.16480 WP_003901239.1.16549 WP_003901239.1.16560 WP_003901239.1.16598 WP_003901239.1.16619 WP_003901239.1.16637 WP_003901239.1.16707 WP_003901239.1.16743 WP_003901239.1.16837 WP_003901239.1.16852 WP_003901239.1.16950 WP_003901239.1.16977 WP_003901239.1.16987 WP_003901239.1.17005 WP_003901239.1.17015 WP_003901239.1.17019 WP_003901239.1.17052 WP_003901239.1.17094 WP_003901239.1.17147 WP_003901239.1.17288 WP_003901239.1.17412 WP_003901239.1.17505 WP_003901239.1.17535 WP_003901239.1.17540 WP_003901239.1.17558 WP_003901239.1.17599 WP_003901239.1.17655 WP_003901239.1.17687 WP_003901239.1.17710 WP_003901239.1.17798 WP_003901239.1.17830 WP_003901239.1.17878 WP_003901239.1.1792 WP_003901239.1.18116 WP_003901239.1.18206 WP_003901239.1.18216 WP_003901239.1.18411 WP_003901239.1.18476 WP_003901239.1.18522 WP_003901239.1.18580 WP_003901239.1.18601 WP_003901239.1.18647 WP_003901239.1.18781 WP_003901239.1.18804 WP_003901239.1.18823 WP_003901239.1.18849 WP_003901239.1.18856 WP_003901239.1.19056 WP_003901239.1.19243 WP_003901239.1.19382 WP_003901239.1.19400 WP_003901239.1.19480 WP_003901239.1.19553 WP_003901239.1.19596 WP_003901239.1.1970 WP_003901239.1.19707 WP_003901239.1.19785 WP_003901239.1.19922 WP_003901239.1.19936 WP_003901239.1.19964 WP_003901239.1.20085 WP_003901239.1.20097 WP_003901239.1.20130 WP_003901239.1.20142 WP_003901239.1.20309 WP_003901239.1.20459 WP_003901239.1.20542 WP_003901239.1.20578 WP_003901239.1.20707 WP_003901239.1.20729 WP_003901239.1.20742 WP_003901239.1.20751 WP_003901239.1.20776 WP_003901239.1.20843 WP_003901239.1.20850 WP_003901239.1.20876 WP_003901239.1.20951 WP_003901239.1.21127 WP_003901239.1.212 WP_003901239.1.21219 WP_003901239.1.21231 WP_003901239.1.21234 WP_003901239.1.2126 WP_003901239.1.2131 WP_003901239.1.21365 WP_003901239.1.21403 WP_003901239.1.21468 WP_003901239.1.21498 WP_003901239.1.21513 WP_003901239.1.21565 WP_003901239.1.21586 WP_003901239.1.21602 WP_003901239.1.21638 WP_003901239.1.21639 WP_003901239.1.21777 WP_003901239.1.21826 WP_003901239.1.2194 WP_003901239.1.21956 WP_003901239.1.21958 WP_003901239.1.21973 WP_003901239.1.21983 WP_003901239.1.22003 WP_003901239.1.22013 WP_003901239.1.22075 WP_003901239.1.2212 WP_003901239.1.22233 WP_003901239.1.22277 WP_003901239.1.22366 WP_003901239.1.22380 WP_003901239.1.22438 WP_003901239.1.22609 WP_003901239.1.22624 WP_003901239.1.22665 WP_003901239.1.22670 WP_003901239.1.22754 WP_003901239.1.22804 WP_003901239.1.22970 WP_003901239.1.22996 WP_003901239.1.23032 WP_003901239.1.2312 WP_003901239.1.23204 WP_003901239.1.23229 WP_003901239.1.2326 WP_003901239.1.23325 WP_003901239.1.2349 WP_003901239.1.23496 WP_003901239.1.23539 WP_003901239.1.23551 WP_003901239.1.23583 WP_003901239.1.23677 WP_003901239.1.23694 WP_003901239.1.2371 WP_003901239.1.23807 WP_003901239.1.23825 WP_003901239.1.23843 WP_003901239.1.2400 WP_003901239.1.24176 WP_003901239.1.24190 WP_003901239.1.24261 WP_003901239.1.24294 WP_003901239.1.24357 WP_003901239.1.24461 WP_003901239.1.24529 WP_003901239.1.24933 WP_003901239.1.24956 WP_003901239.1.2505 WP_003901239.1.25051 WP_003901239.1.25184 WP_003901239.1.25309 WP_003901239.1.25367 WP_003901239.1.25393 WP_003901239.1.25455 WP_003901239.1.2566 WP_003901239.1.25673 WP_003901239.1.25738 WP_003901239.1.2594 WP_003901239.1.26038 WP_003901239.1.26118 WP_003901239.1.26292 WP_003901239.1.26328 WP_003901239.1.26571 WP_003901239.1.2659 WP_003901239.1.26597 WP_003901239.1.26702 WP_003901239.1.26710 WP_003901239.1.26737 WP_003901239.1.26779 WP_003901239.1.26945 WP_003901239.1.26992 WP_003901239.1.27074 WP_003901239.1.27278 WP_003901239.1.27343 WP_003901239.1.27460 WP_003901239.1.27576 WP_003901239.1.277 WP_003901239.1.27750 WP_003901239.1.27795 WP_003901239.1.28092 WP_003901239.1.28131 WP_003901239.1.28159 WP_003901239.1.28161 WP_003901239.1.28367 WP_003901239.1.2842 WP_003901239.1.28473 WP_003901239.1.28497 WP_003901239.1.28530 WP_003901239.1.28545 WP_003901239.1.28561 WP_003901239.1.28567 WP_003901239.1.28585 WP_003901239.1.286 WP_003901239.1.28617 WP_003901239.1.28698 WP_003901239.1.28787 WP_003901239.1.28827 WP_003901239.1.28839 WP_003901239.1.28851 WP_003901239.1.28865 WP_003901239.1.28897 WP_003901239.1.28943 WP_003901239.1.29033 WP_003901239.1.29058 WP_003901239.1.29115 WP_003901239.1.2916 WP_003901239.1.29306 WP_003901239.1.29364 WP_003901239.1.2944 WP_003901239.1.29525 WP_003901239.1.29587 WP_003901239.1.29747 WP_003901239.1.29830 WP_003901239.1.29861 WP_003901239.1.29869 WP_003901239.1.29890 WP_003901239.1.29931 WP_003901239.1.30235 WP_003901239.1.30237 WP_003901239.1.30438 WP_003901239.1.3057 WP_003901239.1.30642 WP_003901239.1.30709 WP_003901239.1.30713 WP_003901239.1.30716 WP_003901239.1.30719 WP_003901239.1.30807 WP_003901239.1.30818 WP_003901239.1.30977 WP_003901239.1.31002 WP_003901239.1.31074 WP_003901239.1.31127 WP_003901239.1.31199 WP_003901239.1.31230 WP_003901239.1.31263 WP_003901239.1.31264 WP_003901239.1.31390 WP_003901239.1.31414 WP_003901239.1.31417 WP_003901239.1.3143 WP_003901239.1.31483 WP_003901239.1.3149 WP_003901239.1.31548 WP_003901239.1.31666 WP_003901239.1.31693 WP_003901239.1.31703 WP_003901239.1.31770 WP_003901239.1.31930 WP_003901239.1.31932 WP_003901239.1.31985 WP_003901239.1.31995 WP_003901239.1.32098 WP_003901239.1.32198 WP_003901239.1.32297 WP_003901239.1.32433 WP_003901239.1.32556 WP_003901239.1.32569 WP_003901239.1.32620 WP_003901239.1.32738 WP_003901239.1.32935 WP_003901239.1.32974 WP_003901239.1.3325 WP_003901239.1.3327 WP_003901239.1.33319 WP_003901239.1.33477 WP_003901239.1.33602 WP_003901239.1.33895 WP_003901239.1.34347 WP_003901239.1.34392 WP_003901239.1.34428 WP_003901239.1.34499 WP_003901239.1.34581 WP_003901239.1.34596 WP_003901239.1.34724 WP_003901239.1.34740 WP_003901239.1.34777 WP_003901239.1.34841 WP_003901239.1.34919 WP_003901239.1.34945 WP_003901239.1.34960 WP_003901239.1.34961 WP_003901239.1.34965 WP_003901239.1.35176 WP_003901239.1.35221 WP_003901239.1.35317 WP_003901239.1.35382 WP_003901239.1.35426 WP_003901239.1.3548 WP_003901239.1.35553 WP_003901239.1.35635 WP_003901239.1.35687 WP_003901239.1.35707 WP_003901239.1.35732 WP_003901239.1.35754 WP_003901239.1.35771 WP_003901239.1.35848 WP_003901239.1.35899 WP_003901239.1.35954 WP_003901239.1.36014 WP_003901239.1.36075 WP_003901239.1.36097 WP_003901239.1.36098 WP_003901239.1.36205 WP_003901239.1.36319 WP_003901239.1.36356 WP_003901239.1.36385 WP_003901239.1.36399 WP_003901239.1.36540 WP_003901239.1.36571 WP_003901239.1.36578 WP_003901239.1.36733 WP_003901239.1.36893 WP_003901239.1.36968 WP_003901239.1.3700 WP_003901239.1.37175 WP_003901239.1.37229 WP_003901239.1.37389 WP_003901239.1.37400 WP_003901239.1.37459 WP_003901239.1.37475 WP_003901239.1.37484 WP_003901239.1.37660 WP_003901239.1.37721 WP_003901239.1.37722 WP_003901239.1.37809 WP_003901239.1.37973 WP_003901239.1.37975 WP_003901239.1.38 WP_003901239.1.38158 WP_003901239.1.38332 WP_003901239.1.38398 WP_003901239.1.38421 WP_003901239.1.38466 WP_003901239.1.385 WP_003901239.1.38530 WP_003901239.1.38594 WP_003901239.1.38660 WP_003901239.1.38672 WP_003901239.1.38772 WP_003901239.1.38821 WP_003901239.1.3889 WP_003901239.1.38991 WP_003901239.1.39190 WP_003901239.1.39236 WP_003901239.1.39295 WP_003901239.1.39306 WP_003901239.1.39521 WP_003901239.1.39616 WP_003901239.1.39654 WP_003901239.1.39728 WP_003901239.1.39759 WP_003901239.1.39804 WP_003901239.1.39848 WP_003901239.1.3994 WP_003901239.1.39959 WP_003901239.1.39960 WP_003901239.1.3997 WP_003901239.1.40150 WP_003901239.1.40277 WP_003901239.1.40323 WP_003901239.1.40336 WP_003901239.1.4036 WP_003901239.1.40402 WP_003901239.1.40413 WP_003901239.1.40455 WP_003901239.1.40523 WP_003901239.1.40646 WP_003901239.1.40723 WP_003901239.1.40876 WP_003901239.1.41202 WP_003901239.1.41231 WP_003901239.1.41447 WP_003901239.1.41469 WP_003901239.1.41504 WP_003901239.1.41564 WP_003901239.1.41632 WP_003901239.1.41744 WP_003901239.1.41791 WP_003901239.1.41829 WP_003901239.1.41921 WP_003901239.1.42043 WP_003901239.1.42122 WP_003901239.1.42134 WP_003901239.1.42409 WP_003901239.1.42430 WP_003901239.1.42467 WP_003901239.1.42494 WP_003901239.1.42524 WP_003901239.1.42704 WP_003901239.1.42705 WP_003901239.1.42722 WP_003901239.1.42842 WP_003901239.1.42905 WP_003901239.1.43005 WP_003901239.1.43009 WP_003901239.1.43053 WP_003901239.1.43208 WP_003901239.1.43273 WP_003901239.1.43296 WP_003901239.1.43475 WP_003901239.1.4377 WP_003901239.1.43815 WP_003901239.1.43861 WP_003901239.1.43872 WP_003901239.1.43885 WP_003901239.1.43897 WP_003901239.1.4390 WP_003901239.1.43921 WP_003901239.1.43960 WP_003901239.1.44 WP_003901239.1.44001 WP_003901239.1.44033 WP_003901239.1.44076 WP_003901239.1.44169 WP_003901239.1.44277 WP_003901239.1.44279 WP_003901239.1.44355 WP_003901239.1.44532 WP_003901239.1.44562 WP_003901239.1.44602 WP_003901239.1.4464 WP_003901239.1.44651 WP_003901239.1.44659 WP_003901239.1.44665 WP_003901239.1.44694 WP_003901239.1.4476 WP_003901239.1.44776 WP_003901239.1.44779 WP_003901239.1.44913 WP_003901239.1.4492 WP_003901239.1.44979 WP_003901239.1.44981 WP_003901239.1.45002 WP_003901239.1.45081 WP_003901239.1.45129 WP_003901239.1.45211 WP_003901239.1.4526 WP_003901239.1.45326 WP_003901239.1.45374 WP_003901239.1.45407 WP_003901239.1.45451 WP_003901239.1.45474 WP_003901239.1.45510 WP_003901239.1.45619 WP_003901239.1.45626 WP_003901239.1.45631 WP_003901239.1.45697 WP_003901239.1.4571 WP_003901239.1.45805 WP_003901239.1.45963 WP_003901239.1.46083 WP_003901239.1.46092 WP_003901239.1.46129 WP_003901239.1.46141 WP_003901239.1.4624 WP_003901239.1.46336 WP_003901239.1.46411 WP_003901239.1.46442 WP_003901239.1.46568 WP_003901239.1.46613 WP_003901239.1.46625 WP_003901239.1.46642 WP_003901239.1.46647 WP_003901239.1.46792 WP_003901239.1.46980 WP_003901239.1.47066 WP_003901239.1.47194 WP_003901239.1.47540 WP_003901239.1.47572 WP_003901239.1.47636 WP_003901239.1.47679 WP_003901239.1.47690 WP_003901239.1.47805 WP_003901239.1.47832 WP_003901239.1.47912 WP_003901239.1.47926 WP_003901239.1.47959 WP_003901239.1.47974 WP_003901239.1.47993 WP_003901239.1.48130 WP_003901239.1.48143 WP_003901239.1.48155 WP_003901239.1.48170 WP_003901239.1.48185 WP_003901239.1.48256 WP_003901239.1.48264 WP_003901239.1.48287 WP_003901239.1.48333 WP_003901239.1.48443 WP_003901239.1.48658 WP_003901239.1.48666 WP_003901239.1.48687 WP_003901239.1.48779 WP_003901239.1.4878 WP_003901239.1.48857 WP_003901239.1.4890 WP_003901239.1.48946 WP_003901239.1.49110 WP_003901239.1.4919 WP_003901239.1.49251 WP_003901239.1.49291 WP_003901239.1.49335 WP_003901239.1.49437 WP_003901239.1.49506 WP_003901239.1.4959 WP_003901239.1.49687 WP_003901239.1.49699 WP_003901239.1.49796 WP_003901239.1.4999 WP_003901239.1.50068 WP_003901239.1.5008 WP_003901239.1.50126 WP_003901239.1.50162 WP_003901239.1.50265 WP_003901239.1.50347 WP_003901239.1.5048 WP_003901239.1.50632 WP_003901239.1.50655 WP_003901239.1.50756 WP_003901239.1.50784 WP_003901239.1.51009 WP_003901239.1.51037 WP_003901239.1.51074 WP_003901239.1.51445 WP_003901239.1.51455 WP_003901239.1.51466 WP_003901239.1.51497 WP_003901239.1.51696 WP_003901239.1.51788 WP_003901239.1.51795 WP_003901239.1.52003 WP_003901239.1.52006 WP_003901239.1.52082 WP_003901239.1.52102 WP_003901239.1.52178 WP_003901239.1.52206 WP_003901239.1.52390 WP_003901239.1.524 WP_003901239.1.52460 WP_003901239.1.52533 WP_003901239.1.52545 WP_003901239.1.52553 WP_003901239.1.52574 WP_003901239.1.52641 WP_003901239.1.52708 WP_003901239.1.52872 WP_003901239.1.52891 WP_003901239.1.52892 WP_003901239.1.52970 WP_003901239.1.53053 WP_003901239.1.5309 WP_003901239.1.531 WP_003901239.1.53143 WP_003901239.1.53157 WP_003901239.1.53213 WP_003901239.1.53217 WP_003901239.1.53229 WP_003901239.1.53254 WP_003901239.1.53257 WP_003901239.1.53278 WP_003901239.1.53353 WP_003901239.1.53381 WP_003901239.1.53480 WP_003901239.1.53606 WP_003901239.1.53730 WP_003901239.1.53754 WP_003901239.1.53775 WP_003901239.1.53803 WP_003901239.1.53888 WP_003901239.1.53952 WP_003901239.1.54125 WP_003901239.1.54162 WP_003901239.1.54179 WP_003901239.1.54275 WP_003901239.1.54351 WP_003901239.1.54531 WP_003901239.1.54537 WP_003901239.1.54553 WP_003901239.1.54633 WP_003901239.1.54705 WP_003901239.1.54732 WP_003901239.1.54836 WP_003901239.1.54860 WP_003901239.1.54888 WP_003901239.1.54905 WP_003901239.1.54909 WP_003901239.1.54937 WP_003901239.1.54953 WP_003901239.1.54964 WP_003901239.1.55023 WP_003901239.1.55128 WP_003901239.1.55140 WP_003901239.1.55210 WP_003901239.1.55227 WP_003901239.1.55257 WP_003901239.1.55307 WP_003901239.1.55328 WP_003901239.1.55578 WP_003901239.1.55626 WP_003901239.1.55723 WP_003901239.1.5574 WP_003901239.1.55819 WP_003901239.1.55849 WP_003901239.1.55882 WP_003901239.1.55894 WP_003901239.1.55909 WP_003901239.1.56178 WP_003901239.1.56292 WP_003901239.1.56341 WP_003901239.1.56365 WP_003901239.1.56478 WP_003901239.1.56577 WP_003901239.1.567 WP_003901239.1.56701 WP_003901239.1.56743 WP_003901239.1.56863 WP_003901239.1.56869 WP_003901239.1.56926 WP_003901239.1.57023 WP_003901239.1.57134 WP_003901239.1.5724 WP_003901239.1.57326 WP_003901239.1.57328 WP_003901239.1.57331 WP_003901239.1.57340 WP_003901239.1.57440 WP_003901239.1.57489 WP_003901239.1.575 WP_003901239.1.57519 WP_003901239.1.57627 WP_003901239.1.57825 WP_003901239.1.57991 WP_003901239.1.58103 WP_003901239.1.5811 WP_003901239.1.58145 WP_003901239.1.58174 WP_003901239.1.58330 WP_003901239.1.58386 WP_003901239.1.58393 WP_003901239.1.5844 WP_003901239.1.58559 WP_003901239.1.58619 WP_003901239.1.58630 WP_003901239.1.5879 WP_003901239.1.59166 WP_003901239.1.59205 WP_003901239.1.59237 WP_003901239.1.59270 WP_003901239.1.59305 WP_003901239.1.59309 WP_003901239.1.59333 WP_003901239.1.59487 WP_003901239.1.59561 WP_003901239.1.59722 WP_003901239.1.59732 WP_003901239.1.59750 WP_003901239.1.59860 WP_003901239.1.59952 WP_003901239.1.59974 WP_003901239.1.6000 WP_003901239.1.60125 WP_003901239.1.60171 WP_003901239.1.60197 WP_003901239.1.6020 WP_003901239.1.60207 WP_003901239.1.60413 WP_003901239.1.60573 WP_003901239.1.6077 WP_003901239.1.61000 WP_003901239.1.61014 WP_003901239.1.61015 WP_003901239.1.61037 WP_003901239.1.61138 WP_003901239.1.61314 WP_003901239.1.61321 WP_003901239.1.61326 WP_003901239.1.61328 WP_003901239.1.61391 WP_003901239.1.61406 WP_003901239.1.61425 WP_003901239.1.61552 WP_003901239.1.61557 WP_003901239.1.61571 WP_003901239.1.61665 WP_003901239.1.61669 WP_003901239.1.61719 WP_003901239.1.6179 WP_003901239.1.61862 WP_003901239.1.61865 WP_003901239.1.61987 WP_003901239.1.62101 WP_003901239.1.62132 WP_003901239.1.62238 WP_003901239.1.6248 WP_003901239.1.62594 WP_003901239.1.62606 WP_003901239.1.62730 WP_003901239.1.62766 WP_003901239.1.62936 WP_003901239.1.63037 WP_003901239.1.63144 WP_003901239.1.63160 WP_003901239.1.63194 WP_003901239.1.63331 WP_003901239.1.6345 WP_003901239.1.63483 WP_003901239.1.63522 WP_003901239.1.63600 WP_003901239.1.63623 WP_003901239.1.63624 WP_003901239.1.63625 WP_003901239.1.63711 WP_003901239.1.63734 WP_003901239.1.63807 WP_003901239.1.63888 WP_003901239.1.63913 WP_003901239.1.63970 WP_003901239.1.64058 WP_003901239.1.64065 WP_003901239.1.6407 WP_003901239.1.64249 WP_003901239.1.64480 WP_003901239.1.64497 WP_003901239.1.64619 WP_003901239.1.64629 WP_003901239.1.64776 WP_003901239.1.64832 WP_003901239.1.64922 WP_003901239.1.65070 WP_003901239.1.65079 WP_003901239.1.65289 WP_003901239.1.65291 WP_003901239.1.65315 WP_003901239.1.65359 WP_003901239.1.65414 WP_003901239.1.65416 WP_003901239.1.65529 WP_003901239.1.65539 WP_003901239.1.65612 WP_003901239.1.65637 WP_003901239.1.65733 WP_003901239.1.65746 WP_003901239.1.65759 WP_003901239.1.65858 WP_003901239.1.65869 WP_003901239.1.65958 WP_003901239.1.6606 WP_003901239.1.66151 WP_003901239.1.6633 WP_003901239.1.66334 WP_003901239.1.66367 WP_003901239.1.66396 WP_003901239.1.66451 WP_003901239.1.66457 WP_003901239.1.66504 WP_003901239.1.66582 WP_003901239.1.66617 WP_003901239.1.66635 WP_003901239.1.66762 WP_003901239.1.66776 WP_003901239.1.66808 WP_003901239.1.66819 WP_003901239.1.66830 WP_003901239.1.66893 WP_003901239.1.67044 WP_003901239.1.67197 WP_003901239.1.67207 WP_003901239.1.67218 WP_003901239.1.67324 WP_003901239.1.67453 WP_003901239.1.67499 WP_003901239.1.67679 WP_003901239.1.67816 WP_003901239.1.67844 WP_003901239.1.67945 WP_003901239.1.67949 WP_003901239.1.68037 WP_003901239.1.68038 WP_003901239.1.68045 WP_003901239.1.68106 WP_003901239.1.68243 WP_003901239.1.68309 WP_003901239.1.68329 WP_003901239.1.68444 WP_003901239.1.68586 WP_003901239.1.68684 WP_003901239.1.68906 WP_003901239.1.68997 WP_003901239.1.6908 WP_003901239.1.69208 WP_003901239.1.69374 WP_003901239.1.69398 WP_003901239.1.69401 WP_003901239.1.6949 WP_003901239.1.69528 WP_003901239.1.69581 WP_003901239.1.69682 WP_003901239.1.69736 WP_003901239.1.69778 WP_003901239.1.69845 WP_003901239.1.70 WP_003901239.1.70000 WP_003901239.1.70017 WP_003901239.1.70055 WP_003901239.1.70255 WP_003901239.1.70271 WP_003901239.1.70364 WP_003901239.1.70368 WP_003901239.1.70444 WP_003901239.1.70471 WP_003901239.1.70668 WP_003901239.1.70699 WP_003901239.1.70757 WP_003901239.1.70834 WP_003901239.1.7084 WP_003901239.1.70864 WP_003901239.1.71015 WP_003901239.1.71083 WP_003901239.1.7113 WP_003901239.1.71191 WP_003901239.1.71255 WP_003901239.1.71464 WP_003901239.1.71665 WP_003901239.1.71701 WP_003901239.1.71731 WP_003901239.1.71778 WP_003901239.1.71803 WP_003901239.1.7185 WP_003901239.1.71851 WP_003901239.1.72072 WP_003901239.1.72168 WP_003901239.1.72179 WP_003901239.1.72268 WP_003901239.1.72401 WP_003901239.1.72441 WP_003901239.1.72452 WP_003901239.1.72460 WP_003901239.1.72488 WP_003901239.1.72492 WP_003901239.1.72576 WP_003901239.1.72578 WP_003901239.1.72853 WP_003901239.1.72938 WP_003901239.1.73006 WP_003901239.1.73013 WP_003901239.1.73025 WP_003901239.1.73134 WP_003901239.1.73154 WP_003901239.1.73182 WP_003901239.1.7321 WP_003901239.1.73365 WP_003901239.1.73436 WP_003901239.1.73470 WP_003901239.1.73629 WP_003901239.1.73661 WP_003901239.1.7368 WP_003901239.1.73723 WP_003901239.1.74101 WP_003901239.1.74129 WP_003901239.1.74210 WP_003901239.1.74282 WP_003901239.1.74304 WP_003901239.1.7432 WP_003901239.1.74347 WP_003901239.1.74487 WP_003901239.1.74499 WP_003901239.1.74511 WP_003901239.1.74523 WP_003901239.1.74525 WP_003901239.1.74551 WP_003901239.1.74683 WP_003901239.1.7469 WP_003901239.1.74725 WP_003901239.1.74760 WP_003901239.1.74809 WP_003901239.1.7496 WP_003901239.1.74988 WP_003901239.1.75202 WP_003901239.1.75234 WP_003901239.1.75342 WP_003901239.1.75395 WP_003901239.1.75510 WP_003901239.1.75598 WP_003901239.1.75671 WP_003901239.1.75749 WP_003901239.1.75878 WP_003901239.1.75927 WP_003901239.1.75946 WP_003901239.1.76045 WP_003901239.1.76052 WP_003901239.1.76058 WP_003901239.1.76126 WP_003901239.1.76157 WP_003901239.1.76277 WP_003901239.1.76616 WP_003901239.1.76640 WP_003901239.1.76644 WP_003901239.1.76677 WP_003901239.1.76734 WP_003901239.1.76744 WP_003901239.1.76750 WP_003901239.1.76754 WP_003901239.1.76757 WP_003901239.1.76888 WP_003901239.1.76963 WP_003901239.1.770 WP_003901239.1.77008 WP_003901239.1.77125 WP_003901239.1.77404 WP_003901239.1.77474 WP_003901239.1.77491 WP_003901239.1.77499 WP_003901239.1.77510 WP_003901239.1.77530 WP_003901239.1.77554 WP_003901239.1.7766 WP_003901239.1.77706 WP_003901239.1.77820 WP_003901239.1.77855 WP_003901239.1.77868 WP_003901239.1.77911 WP_003901239.1.78075 WP_003901239.1.78098 WP_003901239.1.78113 WP_003901239.1.78200 WP_003901239.1.78216 WP_003901239.1.78386 WP_003901239.1.78435 WP_003901239.1.7844 WP_003901239.1.78499 WP_003901239.1.785 WP_003901239.1.78526 WP_003901239.1.78547 WP_003901239.1.78646 WP_003901239.1.78649 WP_003901239.1.78932 WP_003901239.1.78969 WP_003901239.1.78980 WP_003901239.1.79005 WP_003901239.1.79016 WP_003901239.1.79066 WP_003901239.1.79122 WP_003901239.1.79213 WP_003901239.1.79268 WP_003901239.1.79278 WP_003901239.1.79330 WP_003901239.1.79339 WP_003901239.1.79399 WP_003901239.1.79445 WP_003901239.1.79471 WP_003901239.1.79502 WP_003901239.1.79508 WP_003901239.1.79514 WP_003901239.1.79561 WP_003901239.1.79578 WP_003901239.1.79598 WP_003901239.1.79615 WP_003901239.1.79684 WP_003901239.1.79826 WP_003901239.1.79863 WP_003901239.1.79885 WP_003901239.1.79900 WP_003901239.1.80030 WP_003901239.1.80099 WP_003901239.1.80129 WP_003901239.1.80177 WP_003901239.1.80234 WP_003901239.1.8029 WP_003901239.1.80304 WP_003901239.1.80326 WP_003901239.1.8037 WP_003901239.1.8044 WP_003901239.1.80507 WP_003901239.1.80743 WP_003901239.1.80784 WP_003901239.1.8093 WP_003901239.1.81007 WP_003901239.1.8105 WP_003901239.1.81063 WP_003901239.1.81119 WP_003901239.1.81125 WP_003901239.1.81297 WP_003901239.1.8138 WP_003901239.1.8143 WP_003901239.1.81560 WP_003901239.1.81583 WP_003901239.1.81712 WP_003901239.1.81911 WP_003901239.1.81918 WP_003901239.1.82069 WP_003901239.1.82071 WP_003901239.1.82108 WP_003901239.1.82136 WP_003901239.1.82158 WP_003901239.1.82236 WP_003901239.1.82271 WP_003901239.1.82305 WP_003901239.1.82307 WP_003901239.1.82317 WP_003901239.1.8232 WP_003901239.1.82374 WP_003901239.1.82429 WP_003901239.1.82460 WP_003901239.1.82494 WP_003901239.1.82577 WP_003901239.1.82597 WP_003901239.1.82625 WP_003901239.1.82651 WP_003901239.1.82685 WP_003901239.1.8271 WP_003901239.1.82712 WP_003901239.1.82743 WP_003901239.1.82757 WP_003901239.1.82892 WP_003901239.1.83044 WP_003901239.1.83074 WP_003901239.1.8317 WP_003901239.1.83182 WP_003901239.1.83191 WP_003901239.1.8326 WP_003901239.1.83309 WP_003901239.1.83349 WP_003901239.1.8335 WP_003901239.1.83353 WP_003901239.1.83381 WP_003901239.1.83389 WP_003901239.1.83408 WP_003901239.1.83589 WP_003901239.1.83638 WP_003901239.1.83667 WP_003901239.1.83802 WP_003901239.1.83839 WP_003901239.1.83920 WP_003901239.1.83929 WP_003901239.1.83991 WP_003901239.1.8400 WP_003901239.1.84057 WP_003901239.1.84112 WP_003901239.1.84146 WP_003901239.1.8424 WP_003901239.1.84244 WP_003901239.1.84388 WP_003901239.1.84438 WP_003901239.1.84460 WP_003901239.1.84504 WP_003901239.1.84655 WP_003901239.1.84748 WP_003901239.1.84772 WP_003901239.1.848 WP_003901239.1.84836 WP_003901239.1.84981 WP_003901239.1.84985 WP_003901239.1.8503 WP_003901239.1.85043 WP_003901239.1.85284 WP_003901239.1.85319 WP_003901239.1.85341 WP_003901239.1.8546 WP_003901239.1.85478 WP_003901239.1.85480 WP_003901239.1.85488 WP_003901239.1.85551 WP_003901239.1.85577 WP_003901239.1.85648 WP_003901239.1.85704 WP_003901239.1.85808 WP_003901239.1.8586 WP_003901239.1.85913 WP_003901239.1.85953 WP_003901239.1.85986 WP_003901239.1.86025 WP_003901239.1.86032 WP_003901239.1.86048 WP_003901239.1.86052 WP_003901239.1.86122 WP_003901239.1.86249 WP_003901239.1.86368 WP_003901239.1.86499 WP_003901239.1.86561 WP_003901239.1.86718 WP_003901239.1.86801 WP_003901239.1.86820 WP_003901239.1.8685 WP_003901239.1.86851 WP_003901239.1.86867 WP_003901239.1.86892 WP_003901239.1.86941 WP_003901239.1.86963 WP_003901239.1.86979 WP_003901239.1.8700 WP_003901239.1.87002 WP_003901239.1.87116 WP_003901239.1.8714 WP_003901239.1.87240 WP_003901239.1.87275 WP_003901239.1.87401 WP_003901239.1.87409 WP_003901239.1.87459 WP_003901239.1.87494 WP_003901239.1.87634 WP_003901239.1.87658 WP_003901239.1.87684 WP_003901239.1.87707 WP_003901239.1.87732 WP_003901239.1.87809 WP_003901239.1.87827 WP_003901239.1.87831 WP_003901239.1.87835 WP_003901239.1.87866 WP_003901239.1.8789 WP_003901239.1.88205 WP_003901239.1.88219 WP_003901239.1.88315 WP_003901239.1.8840 WP_003901239.1.88489 WP_003901239.1.88537 WP_003901239.1.88592 WP_003901239.1.88616 WP_003901239.1.88625 WP_003901239.1.8870 WP_003901239.1.88737 WP_003901239.1.888 WP_003901239.1.88886 WP_003901239.1.88965 WP_003901239.1.89162 WP_003901239.1.8917 WP_003901239.1.89225 WP_003901239.1.89293 WP_003901239.1.89613 WP_003901239.1.89762 WP_003901239.1.8982 WP_003901239.1.89829 WP_003901239.1.89831 WP_003901239.1.89922 WP_003901239.1.89963 WP_003901239.1.8998 WP_003901239.1.90048 WP_003901239.1.9007 WP_003901239.1.90130 WP_003901239.1.90137 WP_003901239.1.90157 WP_003901239.1.90184 WP_003901239.1.90231 WP_003901239.1.90372 WP_003901239.1.90499 WP_003901239.1.9050 WP_003901239.1.90612 WP_003901239.1.90722 WP_003901239.1.90767 WP_003901239.1.90771 WP_003901239.1.90899 WP_003901239.1.9102 WP_003901239.1.91053 WP_003901239.1.91214 WP_003901239.1.91251 WP_003901239.1.91322 WP_003901239.1.91694 WP_003901239.1.91716 WP_003901239.1.91743 WP_003901239.1.91784 WP_003901239.1.91896 WP_003901239.1.91937 WP_003901239.1.92083 WP_003901239.1.92127 WP_003901239.1.92144 WP_003901239.1.92150 WP_003901239.1.92153 WP_003901239.1.92221 WP_003901239.1.92364 WP_003901239.1.92447 WP_003901239.1.92467 WP_003901239.1.92471 WP_003901239.1.92490 WP_003901239.1.9251 WP_003901239.1.92523 WP_003901239.1.92610 WP_003901239.1.92613 WP_003901239.1.9265 WP_003901239.1.92660 WP_003901239.1.92677 WP_003901239.1.92689 WP_003901239.1.92736 WP_003901239.1.9274 WP_003901239.1.92752 WP_003901239.1.92803 WP_003901239.1.92856 WP_003901239.1.92907 WP_003901239.1.92996 WP_003901239.1.93015 WP_003901239.1.93043 WP_003901239.1.93137 WP_003901239.1.93257 WP_003901239.1.93337 WP_003901239.1.93343 WP_003901239.1.93349 WP_003901239.1.93377 WP_003901239.1.9338 WP_003901239.1.93407 WP_003901239.1.93419 WP_003901239.1.93443 WP_003901239.1.93499 WP_003901239.1.93544 WP_003901239.1.93564 WP_003901239.1.9363 WP_003901239.1.93659 WP_003901239.1.93689 WP_003901239.1.93693 WP_003901239.1.93823 WP_003901239.1.93894 WP_003901239.1.93903 WP_003901239.1.93907 WP_003901239.1.94205 WP_003901239.1.94226 WP_003901239.1.94231 WP_003901239.1.94292 WP_003901239.1.94297 WP_003901239.1.94326 WP_003901239.1.94421 WP_003901239.1.94511 WP_003901239.1.9465 WP_003901239.1.94673 WP_003901239.1.94776 WP_003901239.1.94979 WP_003901239.1.94994 WP_003901239.1.95015 WP_003901239.1.95034 WP_003901239.1.9514 WP_003901239.1.95179 WP_003901239.1.95190 WP_003901239.1.95454 WP_003901239.1.95455 WP_003901239.1.95727 WP_003901239.1.95758 WP_003901239.1.9590 WP_003901239.1.95973 WP_003901239.1.96062 WP_003901239.1.96456 WP_003901239.1.96486 WP_003901239.1.96569 WP_003901239.1.96573 WP_003901239.1.96611 WP_003901239.1.96733 WP_003901239.1.96742 WP_003901239.1.9685 WP_003901239.1.97056 WP_003901239.1.97096 WP_003901239.1.97099 WP_003901239.1.97108 WP_003901239.1.97129 WP_003901239.1.9716 WP_003901239.1.97176 WP_003901239.1.97222 WP_003901239.1.97366 WP_003901239.1.97540 WP_003901239.1.97550 WP_003901239.1.97577 WP_003901239.1.97584 WP_003901239.1.9759 WP_003901239.1.9773 WP_003901239.1.97797 WP_003901239.1.9782 WP_003901239.1.97979 WP_003901239.1.97995 WP_003901239.1.98034 WP_003901239.1.98071 WP_003901239.1.98113 WP_003901239.1.98128 WP_003901239.1.98213 WP_003901239.1.98225 WP_003901239.1.98350 WP_003901239.1.98395 WP_003901239.1.98576 WP_003901239.1.98590 WP_003901239.1.98629 WP_003901239.1.98645 WP_003901239.1.98649 WP_003901239.1.9867 WP_003901239.1.98739 WP_003901239.1.98906 WP_003901239.1.98935 WP_003901239.1.98953 WP_003901239.1.99062 WP_003901239.1.99211 WP_003901239.1.99251 WP_003901239.1.99316 WP_003901239.1.99368 WP_003901239.1.99460 WP_003901239.1.99578 WP_003901239.1.99605 WP_003901239.1.99701 WP_003901239.1.99817 WP_003901239.1.99886 WP_003901239.1.99899 gi|479314651|ref|YP_007854703.1| gi|506926221|ref|YP_008006671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]