SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A051U3Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A051U3Q1
Domain Number 1 Region: 39-142
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A051U3Q1
Sequence length 145
Comment (tr|A0A051U3Q1|A0A051U3Q1_9MYCO) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=1324261 OS=Mycobacterium [tuberculosis] TKK-01-0051. GN=K875_02258 OC=Mycobacterium; Mycobacterium avium complex (MAC).
Sequence
MNFAIVEAMPTSHLTLSTKLVYELGDPNSTLRATADRSGPSVVIYAGGEVDAYNEDTWRH
LVREAATGVTAPGFFVVDVTGLDFMGCCAFAVLAEEAKGCRERDIDLRLVSRDPIVERIV
DACGLGRLLPIYPTVDSALSAAARW
Download sequence
Identical sequences A0A051U3Q1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]