SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A051U5M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A051U5M5
Domain Number 1 Region: 38-133
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A051U5M5
Sequence length 163
Comment (tr|A0A051U5M5|A0A051U5M5_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:KBZ64469.1} KW=Complete proteome OX=1324261 OS=Mycobacterium [tuberculosis] TKK-01-0051. GN=K875_01855 OC=Mycobacterium; Mycobacterium avium complex (MAC).
Sequence
MAAIRSANSADSHDPNRCRYLAHFDRAHLFVYARNLGTVLRVDGEVDASNANDLTGAIRN
FARLKTPLVLDLSHLRFVSVEGFRALLLLNDEFRKARVYCSVVGGAAVRPLLRIVHHNGL
SIAGSVPEAFQNLEDILRARRQFLSDLARPRPAPARTTHSAAS
Download sequence
Identical sequences A0A051U5M5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]