SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A058ZDJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A058ZDJ2
Domain Number 1 Region: 344-530
Classification Level Classification E-value
Superfamily MIR domain 1.22e-34
Family MIR domain 0.00000499
Further Details:      
 
Domain Number 2 Region: 534-707
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.84e-31
Family IP3 receptor type 1 binding core, domain 2 0.0000129
Further Details:      
 
Domain Number 3 Region: 213-306
Classification Level Classification E-value
Superfamily MIR domain 0.0000000222
Family MIR domain 0.019
Further Details:      
 
Domain Number 4 Region: 1549-1578,1636-1673
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000379
Family IP3 receptor type 1 binding core, domain 2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A058ZDJ2
Sequence length 3443
Comment (tr|A0A058ZDJ2|A0A058ZDJ2_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KCV71988.1} KW=Complete proteome; Reference proteome OX=691883 OS=Fonticula alba. GN=H696_01395 OC=Eukaryota; Nucleariidae and Fonticula group; Fonticula.
Sequence
MSQPVGPDAGGGLPADAPGPGLPRAFFDSARSLLLTNGGPSARAGGPGPDLVMGDNDAAS
FLSASSHAASIFSLGDGVALPGLCHGDIIALHVDSDVTPITQHAWGMMSTVGLIDTRCIV
QPSRASPAELRGSGPPLPGYFRDSLFRVCPVKRYSAQNQYSTANARLNAAAVPTEAGDIS
QLSGGSNFSDIVVMKKLQHAAEQERRLNESEESSFLGAPVVYGQQLQLRHVKSHKYLAAE
RRLPALLEKNSMRITFDEFGSEGCWFTIMPAFKLRSLGDQVMVGDQVMLVSSSLGAGLGL
HFSPCPLPDHPDSFEVNVSTQLTPWTIGLYRSHHSAPNAVLKSGDVVRFYHAEQEKFLTC
DLYGDMLSVFLRSTGRALKTEATSSQALWQVEVIGDPVTHHGIGRWGSLFRFRHLPSGAY
MAIDVDADTQIDVTRQRLDPAAGVARPPLHLTVSRNPNDANTLFMMIPTKASGPVGVPQD
SYVRIKHFMTGTWLHSTRLHIDQASGKSVMQKLGAAPLRDPREAFELIPVDAGEVRDLDL
ARESGEFLRDFAQRFVASNVSMSEIRRCSQILQDLIFFVLSADPATSNALTVDGAPDRNR
QKLLREQDVLDGLFEILNAPFLNRKLAPGSEPPSPSRLALSPLATLSLDFLPVRLICQLC
YRLIRHVQKSYRKNQEYIAGRWFGFMQEQIGLGILAEDTITSLLHNNRKLLEATLGRPEV
LTFISLIRVNREAQVPCLSAWRTGPFPWLASLSFSRGLARLGVTQKLICEAVLGDDNADI
LIHLERTPHGVELAWTAKFGADSLESLSVNTSPELLAATGPGGGPLDRAPGAGAGGFCPS
DFDPEDSAHLLRYLEAQLDLFSQMSAERQYAGIDSLRERLPFELVLDCASDSRLPDELRA
SFVKCVCLRPSVSRRLTGVAGGPLCECAASRRVVIPVGSSHPGLSGIALSVKARVLEILD
FICDVRVDYRVSVSLSQFKSQVLEAYLPGRAVPASAAAGPGASGSRFASILPASLRAGSR
AAAVTDGSPPSPADESAGIARTASAGEHLPLLHGSESGPGLVAAPGAGVNGSGADSGPAP
PGWSSRRRFLPLLPAMSTGPGDGQSDGPEAIPLAPLAGGIAAGREDAPPSPGGLLQGPEL
FGASADRSLEMLTEVISRAAAAESAALAAAEAKSAGGAAGTAAPVAPPADPLANAPGWMQ
SRPSGAGRSGAPQRLPFRAGRRVSQEADPHAPDRFSALQSAAAAGGPSQSLSALRNTIFQ
YAIGAEAGRGGAPEEEAGTRRRRSGSRRSRGTLPALEYYGLGDDQLDLDSTPGGVELLRI
LVDLLQFVDHPELTSLALRMLFRHFRQHAEVAHTLAQVQLLISDLDIRNYHEIHDSIDIL
RLAVKGKVALIYDLHSMAASRSPPPSPRLGSLPSPVSAPLANLRDLSYSMAAISMQKICA
SMAGGPATGPGLGPGGPALHDGAGLQASAFSLGAALARSPSATDLLVNALAWSAGGPAGS
EALVLGRRAGSASGRLPPMHHGLANILPMRHPLVDPESVLPVVAASRVLYSRVNRASQRL
GRYLGIHDRVLDLLRHLFVLSPGARGGGGGGGKAGKAGSKAKAKAAAAAATSAVPSTGLP
GSTPRPLAPSTEGSFGNAYDRLVLAAQVHIFLQDFCLGNAQNQKLLLPYVEDLLLPELLH
HVRSRSVVAAALSEEDLEQAGVVGLSALAGPLPRQVDLGSMAALAPGPGGDAEVADPAWP
PVEAHGRLLAGVPVAQLSLLTLARVFANSPALCSAVSEPALLSLLGLLLPEAWPKLGVVA
GAARSAGEPAPAEGLLPVMADRSSVVALLRTLVSTAGTPIRRNQDIVLAALNSSILPELQ
QAGLLPAGLAAPGQLTAPGFVDLPSLEGVIRLVELSRDGDPVTARLAAERLALHVSLVHL
LADCSTGKNTFAQVRCQSILGIEELVMVLTHPLATMPVKHAYVTFLTAVYINSDIDTKEW
IAGPLLWSLLSSVTGDLAGCNRGRWAAAELTSYCSSSMMHCLGALFCSPAGAAAGPPLHH
QIHVFPHSAQHAVLQSLLSGLIGLTECDWLSVKARVDLEATLRLVYDFFTARRLSVKSGL
RSALQLVLSHRAAPGASVRRRRLKEQRRPRAPRDTTLLAAVRAINRHFAAFVQHQNADLH
RPLIAAQQAVLVELFHSPAFLGTSLFIIAHIRSDHGQLVRADVLRVVLKLLVPPRLCAVA
AAYACRQLDLLFGSRVGDGRGLEAFVPAAGGGSPVLGSPGPGSSPTVAVDMSALGRSGGR
RSRPAASRPGPAHVLMQPLSLTQVQLALNHCGVPGLIVDLVAVQVRLRLSLKSPALTFWD
IARLGIAILEGGNSAVQQAIYRRLSGDLLDAAGSAGDFFQVLGGFMRAAIFDLDLTGARS
LPAGPGGVSLPASAPVGLSLSSLSSLRSGAVSFSMLDLTDASLADSPDAGLLADAGADGA
SAGGSAGGAGGLAGAPGDRRTVSGTRSSVPAETRNIELVLRFLQLLCENHTRNLQCLLQR
YGLVRLTADLFTTLCTYSTGSFGVLGFISNDSRLALVNQVLNTLTEFCQGPCQENQLTIA
TYDSPAFEIANNIITSCPDALPADRQVALLQVKANVLNFLLSTIESRKTALVAVGGPGGA
RGAGSPTSAAPPAPTTLAELAAIFTGELYSEDPVVSKLLFYIDLPAFTRTLGGMFELYQL
CTRLLGSALLHAGGQALSGEDAPKSGAQPAAGGSSSCSSSSSPLGDKATGDKSGPDGKPT
DKMDDEAHGAGSSSARIMSQRLQQLQQSSSANLMVHADDLELPAQPASASEISALAGMLG
LGAESRESRLLSSASADLIRAIQLNSRQAAHLVFLLLCHLQPGTPGRLPLAASLADAADA
GAGARPLADLSASEYFARNTGSIEIVVHNELERVYFPIPPVCRFITEESRLHVLNKTERD
EQGSKVPDFYRQIDTLYHEMLWQNQLRKSPVLFGFARNFVNWKHIAFGLAVVINLLLASF
YPIDALSPGVGTAAWWLLTVLGGVQILNAAIVLVSYLINYGALLMRQGRLFRNLLLGYHF
FYLLLCVLGFTVHPFFYGPLLFDIVVRDETLRNVIRSVTRNGRSILMTAFFGLIIVYMFS
LVAFVGLRDDFVIELSEQDEERSCDTLVACLLTSLNHGLRNGGGIGDAIQPNSLQSSSFP
YRFLFDMLFFFVVIIIVLNLIFGVIIDTFADLRSEKNEQEEIRRNTCFICGLSRNSFENR
SLTFEAHTLQDHNLWNYLYFVVHLWTKDSTEYTGPESYVFERLQHSAKGGGADAQGRHHL
DWVPRLRTIALEEDGSPGSGGGGASAAAAAAAAAVAAANGEDGGPAGSGDPDAGDPAGSA
GGPDDASTHQMASAAFRMSMQIGTSLRHLQDVVSSVAAHTHSLRHQDLDRQRDRLRRQMR
LSGGGGGPGAGPAADAGVPRPAW
Download sequence
Identical sequences A0A058ZDJ2
XP_009493566.1.24044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]