SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A058ZUM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A058ZUM5
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Cullin homology domain 4.05e-34
Family Cullin homology domain 0.00032
Further Details:      
 
Domain Number 2 Region: 119-202
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.82e-27
Family SCF ubiquitin ligase complex WHB domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A058ZUM5
Sequence length 202
Comment (tr|A0A058ZUM5|A0A058ZUM5_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW45159.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_L01227 OC=Eucalypteae; Eucalyptus.
Sequence
MVKCVKVFREFYQTKTKHRKLTWIYSLGTCNIIGNFEPRSTELIVTTSQASALLLFNSSD
RLSYSEIMTQLNLTDDDVVRLLHSLSSAKYQILNKEPNTKSIAPTDHFEFNSKFTGKMQR
IRKKVIGDVDRDRRYAIDASIVRIMKSRKVLDHQQLVMECVKQLGPMFKPDLKAIKKRIE
DLISRDYLERGKDNPNLLRYLA
Download sequence
Identical sequences A0A058ZUM5
Eucgr.L01227.2|PACid:23606237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]