SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059ARR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ARR5
Domain Number 1 Region: 48-90
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000343
Family B-box zinc-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059ARR5
Sequence length 133
Comment (tr|A0A059ARR5|A0A059ARR5_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW56667.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_I02368 OC=Eucalypteae; Eucalyptus.
Sequence
MRTLCDACESAAAVVFCAADEAALCSACDDKVHMCNKLASRHVRVGLASPSDVPRCDICE
NAPAFFYCEVDGTSLCLQCDMIVHVGGKRTHGRYLLLRQRVEVGHTIYCLYQHQALVRLF
KFEVSSFVVVSGA
Download sequence
Identical sequences A0A059ARR5
Eucgr.I02368.2|PACid:23597120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]