SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059B7G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059B7G8
Domain Number 1 Region: 109-392
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.72e-78
Family Capz alpha-1 subunit 0.000011
Further Details:      
 
Weak hits

Sequence:  A0A059B7G8
Domain Number - Region: 25-61
Classification Level Classification E-value
Superfamily Coronavirus RNA-binding domain 0.0981
Family Coronavirus RNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059B7G8
Sequence length 403
Comment (tr|A0A059B7G8|A0A059B7G8_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW61841.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_H04534 OC=Eucalypteae; Eucalyptus.
Sequence
MPRLHRNNPDPTLTKPKISRIEFNWYRRARLGTRDGLSLGRRGHTHRNHFSPRGTGPHAD
DEAPPPPRAPFSLLSFSLYLRNPQPHSLSSSGGTAGAMAEEDAPEVELSGEQKKEIAKWF
LLHSPGGEIQYVAKDVRSVLDDDGAYGEAASEAFPAYNKAQMICLDMPRGMGEVLITSFG
ELEENQFLDPRTAQVGIVDHVKQVCTDVRPATDEELPSPYIEEFRCALDAEVLKYVGEAY
PKGVCSVYSTKGKDVEGPGSDFELAVVIQAARNSPQNFCTGSWRSVWNIEFKDDIQILEL
RGKMQVGAHYFEEGNVQLDTKHECKDSTIFQSPEDCAISIASIICHHETEYLGSLEASYT
NLPDNTFKDLRRKLPVTRTLFPWHNTLQFSLTRDISKELGIEK
Download sequence
Identical sequences A0A059B7G8
Eucgr.H04534.3|PACid:23593859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]