SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059BR07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059BR07
Domain Number 1 Region: 56-159
Classification Level Classification E-value
Superfamily HisI-like 1.31e-36
Family HisI-like 0.00016
Further Details:      
 
Domain Number 2 Region: 176-269
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.0000000000000486
Family HisE-like (PRA-PH) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059BR07
Sequence length 283
Comment (tr|A0A059BR07|A0A059BR07_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW68321.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_F01985 OC=Eucalypteae; Eucalyptus.
Sequence
MVVSSSLRLQPARLPAGRVSGGCSSGRRRGRCRVAFASAAGVPGKDVSLQSKVGTLLDSV
KWDDKGLAVAIAQNVDTGAILMQGFVNRDALAATISSRKATFYSRSRSSLWTKGETSRNF
INISDVFLDCDRDSIIYLGKPDGPTCHTGSETCYFSSIEDILEPSQVTRNELALSTLYSL
ESTISRRKAELAEPQDGKPSWTKRLLLDNKLLCSKVREEADELCRTLEENEDTARTASEM
ADVLYHSMVLLAVRDVKMEEVLEILRHRFSRSGIEEKKSRTKG
Download sequence
Identical sequences A0A059BR07
Eucgr.F01985.1|PACid:23582733 XP_010061389.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]