SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059CY98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059CY98
Domain Number 1 Region: 182-221
Classification Level Classification E-value
Superfamily SAP domain 0.000000013
Family SAP domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059CY98
Sequence length 224
Comment (tr|A0A059CY98|A0A059CY98_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW83156.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_B00112 OC=Eucalypteae; Eucalyptus.
Sequence
MGTRVRMLKIINDMDWLHKFSGDQPPFGNISRDQRSSFGLVFPCSSLTRVASLSLSSLNS
VARIRRRGGGPSGGHGRQLQPPLPSESDGVQAPLQPPLPRPLLLYRPLLQSEGQVIKTNQ
QNILIRALTIRKQRGEPSLRTAKGVAIAEGSRKRASERLLDSGTSSKRPAGQAGSRQEGS
SNHLLDRDLHSLTVERLRALLKERGLSTKGKKDDLITRLKSAIG
Download sequence
Identical sequences A0A059CY98
Eucgr.B00112.1|PACid:23565162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]