SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059DBH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A059DBH5
Domain Number - Region: 40-87
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00719
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059DBH5
Sequence length 183
Comment (tr|A0A059DBH5|A0A059DBH5_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW87580.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_B04026 OC=Eucalypteae; Eucalyptus.
Sequence
MRGTGVVENSSTGHDDMMSMSMSVSMATHGQRQRPGIPHSNICTICSTYIYIFRRRCLVC
GRVYCRQCASIGMGEMTEGRKCVECLGRRFSQRYIQRAGQIGCCSRCPSTVKQAELKWAE
KGPRRTAERAYGRGRMASRSRSPVTSRTPTRAHPSSISINASNPPSFVYSPYSPHSQRHH
IPF
Download sequence
Identical sequences A0A059DBH5
Eucgr.B04026.1|PACid:23569480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]