SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059ELW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ELW4
Domain Number 1 Region: 123-245
Classification Level Classification E-value
Superfamily MIR domain 0.00000602
Family MIR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059ELW4
Sequence length 430
Comment (tr|A0A059ELW4|A0A059ELW4_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KCZ75749.1} KW=Complete proteome; Reference proteome OX=1240240 OS=Anncaliia algerae PRA109. GN=H311_03266 OC=Tubulinosematidae; Anncaliia.
Sequence
IFLTLSIYFFVLYSKYQKFIHLLSTGISLGLLLSVKWTGLFTIIHLGVYFLYEIYNMLKF
RFKDACKKLYHYVFCLLLIPITIYIASFYIHFLILNNPSDELIKMDSAFQTMYSMKNKEF
IQYGDIINIKHKNLSGGLMHMYTTPKRFVSLSFGYNKHEDFIFQSFKPKKFVESDEFVMI
YNLTNQNYLCVDKNVSSRKKFNKSCVFKIKTKEKKESPVYNDTSVFFLNLKSNCYLSVSN
KTILEQRIIECSNKKEYFTIEDSIKREKSSLNPSFFSLFLELNKRMFLINQSFILDADLN
PKYFTSTPKEWLFLNKRIYFKPENKYKFAFSINKVIWYFASSFIIFLPFKVFFTKSKKMF
FVYFFYLGWLINYLPYFFMKRVMYFHHYLPAYMYSVLLLAHSFQSVKSLQFIILLGAAYF
LYTSQYLYGY
Download sequence
Identical sequences A0A059ELW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]