SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059ESI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ESI1
Domain Number 1 Region: 4-106,163-224
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 4.58e-17
Family Protein prenylyltransferase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059ESI1
Sequence length 233
Comment (tr|A0A059ESI1|A0A059ESI1_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KCZ77709.1} KW=Complete proteome; Reference proteome OX=1240240 OS=Anncaliia algerae PRA109. GN=H311_01275 OC=Tubulinosematidae; Anncaliia.
Sequence
INLKALMTNPKSYSAWNYRLMLANNGLDLNEEDKLTRKLINYDKRNFHCWNYRRKLNLSV
IYDYFNYSCLHDLVSKNESINSVDIIYTNPYYEGSLYLFHRINYNYYLKKYQNITYLHFK
SPFKGELLVNNKVINIPHPVLLIKLDDKEIKEIIIDDIIHKECEDDYNYSFIDELLELEP
DCVNLLLMKLKITENYDLRNKLINKLINVDPMRKMWYNSLINAYYKIIPLIKI
Download sequence
Identical sequences A0A059ESI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]