SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059ETZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ETZ9
Domain Number 1 Region: 125-168
Classification Level Classification E-value
Superfamily Nop domain 0.00000000102
Family Nop domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059ETZ9
Sequence length 169
Comment (tr|A0A059ETZ9|A0A059ETZ9_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KCZ78352.1} KW=Complete proteome; Reference proteome OX=1240240 OS=Anncaliia algerae PRA109. GN=H311_00615 OC=Tubulinosematidae; Anncaliia.
Sequence
MQIFYETPFKYFLLDVNDANISVIAEHTLSDPFESLDNILLLQKGIISDDIKIFLEKNGG
DTIYLTDESLIKQFNKLFSNKEFLYDLNLVRTIKENISSFVDLSKYSKELLCISHKLANN
KLENKEKMDVIITETLSLIDSLERDINLHVMRIKEWYSNHFPELQDLIS
Download sequence
Identical sequences A0A059ETZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]