SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059EZR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059EZR1
Domain Number 1 Region: 274-444
Classification Level Classification E-value
Superfamily MIR domain 4.97e-35
Family MIR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059EZR1
Sequence length 646
Comment (tr|A0A059EZR1|A0A059EZR1_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KCZ80206.1} KW=Complete proteome; Reference proteome OX=1288291 OS=Anncaliia algerae PRA339. GN=H312_02386 OC=Tubulinosematidae; Anncaliia.
Sequence
MKKLLNQRYLYPLTIFLTNILIKFYKIESGNFVIWDEAHFGKFSRNYLKRQFYFDVHPPL
GKLMTAVSGYLFGQDTDFEFESGSEYPPQMDYTGMRRFHAFISAFVPVLMYGTCRNLGYS
KSFSFYSTFFYVFENGNVSISRLILLDSHLLFFTAFVIFFFSLWRQRKSILNISYLGISI
GLTLSVKWIGCFTTFFVGVYVIDELYKSLKEEKLSSFFKRFLIRFIFLIIVPVAVYLFWF
VVHFKILVHSSSDEANMSSLFQINLIEHKNKKLGKYVDFGRAITIKSNKLSGGNLHSHST
NYPNKNDQQVTIYHHKDDNDNWIIQKIADDEDSPDFLKNNDKVLLLHGQTRKYLSVFGPA
LISQGKRAGGYSELTQQSVFQVQIEKDIIKNEVYVKTLTTKFRLYSVYEDCYLQPSGKQL
PEWGFSQGEVICSKNKSNQSLWNIEKNENFSEKNIHYAEVFNLKFQFFTHFLELNKTMFR
VNSSFIQDNDLEPQRIVSSPKEWMFLRRGLRMVSWDDSRKKFYMFGNPFIWLISSICVLI
SPIVYLFSRKKQKNDSFEFYLCFFGYICHYLPFFFIGRVLYFHHYFPAMLFSTLSIGYVL
KRMRNLIPYLILISFITFIIYAPLTYGFYKVNYLKYFSIFKTWDYL
Download sequence
Identical sequences A0A059EZR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]