SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059F137 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059F137
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-35
Family Calponin-homology domain, CH-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059F137
Sequence length 175
Comment (tr|A0A059F137|A0A059F137_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KCZ80822.1} KW=Complete proteome; Reference proteome OX=1288291 OS=Anncaliia algerae PRA339. GN=H312_01769 OC=Tubulinosematidae; Anncaliia.
Sequence
MVDDKFKEQAIEWIQSILEVEIKDFYLDLKDGIILCKLMNEIMPGSCKISNFKLPFHQIE
NVNQFIAAAKRLGVPDYENFELNDLYEAKSIKQVLICLSSVSRQATKLGWEGPVFGPKLS
EQKKYNFSEETLRKGESMASLQEGFFVDMSSSTVNDGGIRRQITKDNNYLRNKDL
Download sequence
Identical sequences A0A059ETP2 A0A059F137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]