SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059FCJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059FCJ6
Domain Number 1 Region: 439-522
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059FCJ6
Sequence length 551
Comment (tr|A0A059FCJ6|A0A059FCJ6_9RHOB) Sulfate transporter {ECO:0000313|EMBL:KCZ88317.1} KW=Complete proteome; Reference proteome OX=1280950 OS=Hyphomonas johnsonii MHS-2. GN=HJO_15683 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MVKSTLAAFADRISAADWAGNGLSAMTPMRVKTELLAGFTVALALIPEAVAFAFVAGVTP
LSGLYAAFIVGLITALFGGRPGMISGATGALAVVMVGLVHDPRIAEGMGPQYLFATVVLM
GLLQLLAGVFKLGKFMRLVPHPVMLGFVNGLAIVIFLAQLSQFKVPGTAEASGHGFAGGE
WMNGAPLAIMLGLTALTMAIIWGMPKLTKIIPAPLAGIGIVAGIVIGFGLNVPTVGDLAS
VKGGLPPFAVPTVPMTFETLRIIFPYALILAAIGLIESLLTLNLVGEITGKRGGASQECL
AQGTANVVTGFFGGMGGCAMIGQSMINVKSGGRTRLSGVSAALFLLAFILVGSSLIERIP
LAALVGVMFMVVIGTFAWQSLRIMTRIPLMDAFVIVLVTGVTVAYDLATAVVVGVIVSAL
AYAWNNARRIHVIERDSIREPGAHVYEIEGPLFFGSTDGFAELFHPETDPDVVIVDFRRS
RVVDQSALQAIEDLAARYAAHGKTLRLRHLSRDCHKLLKRAGQLIVDMDDDPDYALAADY
NVRIGVFGGAH
Download sequence
Identical sequences A0A059FCJ6
WP_035618863.1.13193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]