SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059G703 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059G703
Domain Number 1 Region: 716-953
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 2 Region: 431-607
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000053
Family PFOR PP module 0.061
Further Details:      
 
Domain Number 3 Region: 42-194
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000589
Family Pyruvate oxidase and decarboxylase Pyr module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059G703
Sequence length 1152
Comment (tr|A0A059G703|A0A059G703_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KDA02494.1} KW=Complete proteome OX=1280953 OS=Hyphomonas oceanitis SCH89. GN=HOC_09749 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MKHREVTLDDKYELVEGNAFMTGIQALVRLPLDRKRLDIGSGHNTAGFISGYRGSPLGGY
DQQLRAVQPLLDSHNIQFWEGLNEDLGATAVWGSQQLGLFPGARYDGLFGIWYGKAPGVD
RTGDVFKHANAAGTSALGGVLAIIGDDHNCKSSTLPSQSEFAMADAEIPVLNPASIQDVL
DYGIHGWNMSRFSGAWTGLVALADTMDSGSVVNVSLDRFAFAEPGFHMPEAGVHMRRGDT
PLDKEARLRHFKLPAAQAYVRANRLDHVVIPSPKPRIGVIVTGQAARDVFEALAAIGLSP
EEAGRLGLTVYKVAMPWPLEPEGVREFCAGLERVVVIEHKRPLIEEQLKAALYDLPDSQR
PRIEGKRAANGEPLLSDVASISIPEMAHALMKIIPAGWDTARADAYFDRVGRAGEAARGN
ASETVRSPHFCSGCPHNTSTTVPEGSRALAGIGCHYMANFMPDRKTDMTSQMGGEGIAWV
GQHWATDEDHVFVNLGDGTYSHSGSLAIRAAVTSGAKMTYKILYNDAVAMTGGQHVESGQ
TPAQIAQQVEAEGVKTIVIVTEDPTRYAGVKNLPRSVKIFDREDLEDVQVMLRATPGVSV
MIYDQMCATEKRRRSKRGIIAPDRVRVIINTEVCEGCGDCSIKSNCLSVEPVETELGRKR
RINQSSCNTDLSCLTGFCPSFVTVKDGEPAWTGEVRREFDASNLPLPETPSLAAPWNVLF
TGVGGTGVTTVAAVLAMAAHVDGNAASSLDMTGLAQKGGPVLSHIRFAREPEDISTGRVP
PASADLIIACDLVVAAGGDALLLMDPTRTAAYANSDVTPTSEFIRNRSKRFESDLLAGRV
KRQARDFGAFDAEALAVGYLHDAIYTNMIMVGYSWQKGAVPVSLRGLYRAIRLNGTKVDD
NMAAFNIGRIAAAAPERLAQQHDPRGHLEPKTLDELIDDRAKRLTAYQNAAYAQAYRDAV
TRVRSAEEAAGLGDKLTRAAATYAYKLMAYKDEYEVARLYTDGSFAAQLASQFKGGKLRF
WLAPPIMSKKDSHGHLKKKHFGGWMMLGFKLLTKLKGLRETPFDLFGRTEERKMERALRD
TYLETLETLASGLTVKNHAVAVAIAEVPDEIRGYGHVKEAAVAVASETEAALWKGWPTGD
MPKAKTTLIAAE
Download sequence
Identical sequences A0A059G703
WP_035537993.1.10701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]