SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059HU32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A059HU32
Domain Number - Region: 39-82
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059HU32
Sequence length 201
Comment (tr|A0A059HU32|A0A059HU32_CAMJU) Uncharacterized protein {ECO:0000313|EMBL:KDA34813.1} KW=Complete proteome OX=1365662 OS=Campylobacter jejuni K5. GN=N218_15435 OC=Campylobacteraceae; Campylobacter.
Sequence
MKIILLTILSFLSLWGLSFDELIYKNEVRASFDCSKVKNNGKNDDELIICNKIGAINEFE
NKKLALMDNIFISLYQELLKNANEIIKEDFKLVVKKMFRERKNCAKVISNDLLQADQDPQ
SPFVYKTDCIEKTYAKVFLELMQKAKKDTQSKERLKQIFNNQVDRYENLIQMSIQDPIDL
EIFIDNLAQEGLIDDNARLKL
Download sequence
Identical sequences A0A059HU32
WP_002789871.1.101679 WP_002789871.1.101828 WP_002789871.1.101954 WP_002789871.1.10339 WP_002789871.1.11106 WP_002789871.1.1227 WP_002789871.1.15120 WP_002789871.1.15724 WP_002789871.1.15743 WP_002789871.1.16024 WP_002789871.1.16186 WP_002789871.1.16501 WP_002789871.1.17780 WP_002789871.1.18531 WP_002789871.1.19345 WP_002789871.1.19578 WP_002789871.1.20616 WP_002789871.1.2127 WP_002789871.1.21613 WP_002789871.1.21632 WP_002789871.1.22283 WP_002789871.1.22536 WP_002789871.1.24253 WP_002789871.1.2457 WP_002789871.1.25866 WP_002789871.1.25990 WP_002789871.1.27341 WP_002789871.1.2740 WP_002789871.1.28701 WP_002789871.1.28978 WP_002789871.1.30980 WP_002789871.1.31795 WP_002789871.1.32012 WP_002789871.1.32436 WP_002789871.1.32952 WP_002789871.1.32990 WP_002789871.1.33757 WP_002789871.1.33844 WP_002789871.1.35646 WP_002789871.1.36218 WP_002789871.1.37491 WP_002789871.1.38227 WP_002789871.1.39644 WP_002789871.1.41028 WP_002789871.1.42922 WP_002789871.1.43370 WP_002789871.1.44554 WP_002789871.1.44846 WP_002789871.1.46723 WP_002789871.1.47495 WP_002789871.1.48611 WP_002789871.1.50504 WP_002789871.1.51740 WP_002789871.1.52640 WP_002789871.1.53576 WP_002789871.1.55428 WP_002789871.1.56209 WP_002789871.1.5704 WP_002789871.1.57441 WP_002789871.1.5765 WP_002789871.1.57830 WP_002789871.1.58332 WP_002789871.1.58441 WP_002789871.1.59063 WP_002789871.1.61907 WP_002789871.1.62187 WP_002789871.1.63259 WP_002789871.1.63692 WP_002789871.1.65167 WP_002789871.1.66218 WP_002789871.1.66352 WP_002789871.1.67543 WP_002789871.1.67911 WP_002789871.1.68973 WP_002789871.1.69368 WP_002789871.1.69527 WP_002789871.1.69883 WP_002789871.1.70773 WP_002789871.1.72070 WP_002789871.1.73654 WP_002789871.1.73816 WP_002789871.1.74553 WP_002789871.1.74729 WP_002789871.1.77506 WP_002789871.1.77821 WP_002789871.1.78670 WP_002789871.1.7903 WP_002789871.1.80648 WP_002789871.1.80708 WP_002789871.1.81213 WP_002789871.1.81536 WP_002789871.1.83147 WP_002789871.1.83583 WP_002789871.1.84717 WP_002789871.1.85930 WP_002789871.1.86369 WP_002789871.1.8665 WP_002789871.1.86857 WP_002789871.1.88778 WP_002789871.1.90575 WP_002789871.1.90677 WP_002789871.1.91333 WP_002789871.1.9148 WP_002789871.1.92870 WP_002789871.1.94821 WP_002789871.1.96091 WP_002789871.1.96153 WP_002789871.1.96207 WP_002789871.1.99916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]