SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059I9Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A059I9Q1
Domain Number - Region: 6-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0759
Family KRAB domain (Kruppel-associated box) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059I9Q1
Sequence length 81
Comment (tr|A0A059I9Q1|A0A059I9Q1_ENTAG) Uncharacterized protein {ECO:0000313|EMBL:KDA93815.1} KW=Complete proteome OX=1408177 OS=Pantoea agglomerans Eh318. GN=T296_14555 OC=Erwiniaceae; Pantoea; Pantoea agglomerans group.
Sequence
MRQNGQAPETISDIARYFNQASSPSQQETLGSVVVEILRAGHSLSRKTICSKLLSRLELA
ATPEEESHLHELIAMLFRRED
Download sequence
Identical sequences A0A059I9Q1 A0A0L7DF87 A0A1W9ESW7
WP_010246891.1.101893 WP_010246891.1.12349 WP_010246891.1.17825 WP_010246891.1.21352 WP_010246891.1.27901 WP_010246891.1.29463 WP_010246891.1.31673 WP_010246891.1.36637 WP_010246891.1.37249 WP_010246891.1.41494 WP_010246891.1.49876 WP_010246891.1.53784 WP_010246891.1.64476 WP_010246891.1.65004 WP_010246891.1.66525 WP_010246891.1.71197 WP_010246891.1.71389 WP_010246891.1.73970 WP_010246891.1.79726 WP_010246891.1.80375 WP_010246891.1.81462 WP_010246891.1.91744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]