SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059IAP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059IAP1
Domain Number 1 Region: 10-47
Classification Level Classification E-value
Superfamily Ribosomal protein L36 1.44e-16
Family Ribosomal protein L36 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059IAP1
Sequence length 47
Comment (tr|A0A059IAP1|A0A059IAP1_ENTAG) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome OX=1408177 OS=Pantoea agglomerans Eh318. GN=T296_12245 OC=Erwiniaceae; Pantoea; Pantoea agglomerans group.
Sequence
MVEKLRRVKMKVRASVKRLCRNCKIIRRDGVVRVICSAEPKHKQRQG
Download sequence
Identical sequences A0A059IAP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]