SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059IR46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059IR46
Domain Number 1 Region: 720-953
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 2 Region: 22-205
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000124
Family Pyruvate oxidase and decarboxylase Pyr module 0.052
Further Details:      
 
Domain Number 3 Region: 435-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000353
Family Pyruvate oxidase and decarboxylase PP module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059IR46
Sequence length 1135
Comment (tr|A0A059IR46|A0A059IR46_9RHOB) MFS transporter {ECO:0000313|EMBL:KDB04493.1} KW=Complete proteome; Reference proteome OX=1417296 OS=Defluviimonas sp. 20V17. GN=U879_06495 OC=Rhodobacteraceae; Defluviimonas.
Sequence
MTVPRPHLAPYQLEDRYTRTEGRVFLTGTQALVRILLDQARRDRAAGLNTAGFVSGYRGS
PLGAVDLEMWRAAKRLEAARITFMPAVNEDLGATAVLGAQQAVLDPDCEVEGIFSMWYGK
GPGIDRSGDALRHGNAYGSSPKGGVLVVAGDDHGCVSSSMPHQSDVAFMTWFMPTLNPAD
VGEYLSFGEYGLALSRFSGTWVGFKAISETVESGRSVELPPDRAFTLPQIELPPGGLHVR
PADLPSAEIETRIGHKLRAVEAFVEANPIDRRIYDIAQASYGFVTTGKGHLDLMEALRLL
GLDEAACRRLGIDIYKVGMVWPLARRAALDFVKDKREVLVIEEKRGIIESQFKEYFYDWP
GHKPEKMVGKHDAAATRDLVPWTGELSPLILAPIIAERLDAFFPDENLPARAAALCEKAV
PVLSVPGATRTPYFCSGCPHNTSTRVPKGSKAASGIGCHVMASWMGRDTDGYAQMGGEGV
PWVVASKYNGGKHQFQNLGEGTWYHSGSLAIRQAVAAHTNITFKILYNDAVAMTGGQPVD
GPISVQGIAQTSRAEGVDRIALVSDDITKFRRADFPPGTSFHDRADLDAVQRELREVKGV
SVLIYEQTCATEKRRRRKRGTLPDPAKFAVINEAVCEGCGDCSIASNCLSVEPVETEFGR
KRRINQSSCNKDFSCLGGFCPSFVTVEGGRRRRRTGAEIDLPALKVDLPAPEIPAISAPY
DLLVTGVGGTGVVTVGALITMAAHLEGLGASVLDFTGFAQKFGTVLSYIRLASGPEALNQ
VRIETGAADAVIGCDAVVSSSPKASAHYRAGTRMVLNTAAMPTGDLVLNRDADLKIPARE
AAIGAAIGAENLAAFDANALAERFMGEAVFANVMMLGYAWQNGLVPLSEAALKQAIALNG
VAIEANARAFDLGRVMAARPEALAPPPPAPVAALDALIDNRAAFLTDYHDETLARRFRDK
ITALRARADEDCARAAAHSLFKLMAVKDEYEVARLQTDPAFIRQLADQFEGDFTLSYHFA
PPVLPLGRDARGRPKKRRFGPWIAPLLRGLARARRLRGSWADPFRFSADRRLDRDLLAWF
EELLDRAARDYRPQDKALWTEVLGAPDGIRGYGPVREEAARKVRAAVAGRLAGRG
Download sequence
Identical sequences A0A059IR46
WP_035840321.1.44061 WP_035840321.1.4639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]