SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059IZG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059IZG0
Domain Number 1 Region: 15-154
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.7e-38
Family Ribosomal protein S13 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059IZG0
Sequence length 155
Comment (tr|A0A059IZG0|A0A059IZG0_9EURO) 40S ribosomal protein S18 {ECO:0000313|EMBL:KDB20909.1} KW=Complete proteome; Reference proteome OX=1215338 OS=Trichophyton interdigitale MR816. GN=H109_07138 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MSLVSGEKSNFQFILRLLNTNVDGKQKIMYALTKIKGVGRRYSNLVCKKADVDLHKRAGE
ISSEELERIVTIIQNPTQYKIPTWFLNRQRDITDGKDTQVLANQMDSKLREDLERLKKIR
AHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKG
Download sequence
Identical sequences A0A022WGZ2 A0A022Y7M1 A0A059IZG0 A0A178FB19 A0A178FCZ1 D4AZ70 D4DLI0 F2S2H4
TESG_05175T0 TERG_08254T0 XP_003012230.1.35196 XP_003017934.1.33076 XP_003231164.1.23396 TRV_08054 ARB_01490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]