SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059J4R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059J4R2
Domain Number 1 Region: 7-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000242
Family Ribosomal protein L24e 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059J4R2
Sequence length 160
Comment (tr|A0A059J4R2|A0A059J4R2_9EURO) 60S ribosomal protein L24 {ECO:0000313|EMBL:KDB22840.1} KW=Complete proteome; Reference proteome OX=1215338 OS=Trichophyton interdigitale MR816. GN=H109_05255 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MRTYDDSFSGQKIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRKNPRRIAWTILYRRQHK
KGLSEEVAKKRTRRVVKHQRAIVGASLDVIKERRTMRPEARAAARQAAVKEAKEKKSAAE
SKKRAEKAKAAQASARGQGGRIQSKQGAKGSAPKVAAKSR
Download sequence
Identical sequences A0A059J4R2 F2Q120 F2S5R1
TEQG_06771T0 TESG_06272T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]