SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059KK80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059KK80
Domain Number 1 Region: 752-998
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0087
Further Details:      
 
Domain Number 2 Region: 28-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-18
Family Pyruvate oxidase and decarboxylase Pyr module 0.047
Further Details:      
 
Domain Number 3 Region: 464-652
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.24e-17
Family PFOR PP module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059KK80
Sequence length 1179
Comment (tr|A0A059KK80|A0A059KK80_9BURK) Pyruvate/ketoisovalerate oxidoreductase {ECO:0000313|EMBL:KDB51866.1} KW=Complete proteome; Reference proteome OX=1286631 OS=Sphaerotilus natans subsp. natans DSM 6575. GN=X805_25080 OC=Sphaerotilus.
Sequence
MNAPLPDAVRRALEHITLDDKYTLDRGRAFMSGVQALVRLPMLQRQRDRAAGLDTAGFIS
GYRGSPLGTYDQSLWAAKQHLAEHRIVFQPGVNEELAATAVWGTQQLDLFPQTKKHDGVF
GIWYGKGPGVDRCIDVFKHANMAGTARHGGVLAIAGDDHIAKSSTAAHQSDHVFKACGMP
VFFPSTVQEILDHGLHAIALSRYAGVWSGMKTIQEVVESSSSVSVDPDRVDIVLPEDFLM
PPGGLHIRWPDAPLEQEARLMDHKWYAALAYIRANRLNHNVVEGPNDRFGLIASGKAYND
LRQALHDLGLDDATCRAIGVRVHKVGVVWPLEASITRRFAEGLQEILVVEEKRQMIEYQL
KEELYNWRADVRPNVLGKFDEPDGDQSGGEWSMPNPSQNWLLRAKADLTPSIIARAVARR
LKRLGVPAEVAARMDERLRVIDAREQALAAQAKAPVGERTPWFCSGCPHNTSTRVPEGSR
ALAGIGCHYMATWMDRDTVTFSQMGGEGVAWVGQAPFTTDAHVFANLGDGTYFHSGLLAI
RQSIASGVNITYKILYNDAVAMTGGQRVGERPEGHSVPQIMQTLVAEGVAKLVIVSDDPA
KYAGVALSPGVTVHHRDELDTIQRQFRELKGTTAIIYDQTCATEKRRRRKRGTMADPARR
VVINEAVCEGCGDCSVQSNCLSVEPVETEFGRKRRINQNSCNKDFSCVKGFCPSFVTVEG
GQLKKPQRQKKGDLAALPPLPEPVLPVAESAWGIVVAGVGGTGVITIGQILGMAAHLEGK
GVVTQDAAGLAQKGGATWSHIQIANRPEALFTTKVDTAQADLVIACDPLVAAQRPTLATM
QPGRTWVALNRHGAPTASLVRNPDWQFPQVGCDTALETAVGAQGLGAFDAEQAATELLGD
SIYANPLLLGYAWQHGRIPLGRAAILRAMELNGVQVAANQAAFEWGRRCAHDLSGVRSLF
AAQKVIQIVRRPSLDETIARRTEFLVAYQNAAYAEQYRAFVARVREAEAPLSSTRLTEAV
AQGLFKLMAYKDEYEVARLHADGAFAAKIGEMFDGEVKLVHHFAPPILGRTDAQGRPLKQ
AFGPWMHRALPWLARLKFLRGTAFDPFGRTEERRTERALIQDYRASVEALLARLSKERLA
DAVEIARLPLEIRGFGHVKAANLAKVRAKWAALEAAGRG
Download sequence
Identical sequences A0A059KK80
WP_037482489.1.49787 WP_037482489.1.61402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]