SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059KTW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059KTW9
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059KTW9
Sequence length 160
Comment (tr|A0A059KTW9|A0A059KTW9_9PSED) Anti-anti-sigma factor {ECO:0000313|EMBL:KDD65456.1} KW=Complete proteome OX=1419583 OS=Pseudomonas mandelii PD30. GN=V466_29910 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSTGRIQFAEQDGTFVLKFVGEVRLTLCSALDATIERIFTALNFNAIVIDLTETRSIDST
TLGLLAKLSILSRQKVGLLPTVVTTHEDITRLLQSMGFEQVFNIVDRPIPCPECLTDLPD
QDQSEEVVRIKVLEAHKILMGLNDSNREAFHDLVNALERH
Download sequence
Identical sequences A0A024EI07 A0A059KTW9 A0A0D8ZYQ2 A0A0F4V6D4 A0A0K1QWF5 A0A0N0UBE8 A0A0N1DKS2 A0A0P7KAH1 A0A0Q6QNF6 A0A173JFP5 A0A1H2JJH4 A0A1H5IB82 A0A1S8H5A8 A0A291AK88 J2TTA1 J2WW34 J3BSP1 W6V6S6
WP_007935262.1.12362 WP_007935262.1.14589 WP_007935262.1.17603 WP_007935262.1.19334 WP_007935262.1.25431 WP_007935262.1.27187 WP_007935262.1.27599 WP_007935262.1.38139 WP_007935262.1.43699 WP_007935262.1.44535 WP_007935262.1.48913 WP_007935262.1.49313 WP_007935262.1.51964 WP_007935262.1.55513 WP_007935262.1.55540 WP_007935262.1.55965 WP_007935262.1.56480 WP_007935262.1.57959 WP_007935262.1.63163 WP_007935262.1.64685 WP_007935262.1.65909 WP_007935262.1.68762 WP_007935262.1.69254 WP_007935262.1.72539 WP_007935262.1.78034 WP_007935262.1.91498 WP_007935262.1.96142 WP_007935262.1.99925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]