SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059LH77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059LH77
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily MIR domain 4.71e-25
Family MIR domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059LH77
Sequence length 122
Comment (tr|A0A059LH77|A0A059LH77_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:KDD73687.1} KW=Complete proteome; Reference proteome OX=1291522 OS=Helicosporidium sp. ATCC 50920. GN=H632_c1926p0 OC=Chlorellaceae; Helicosporidium.
Sequence
MKTGEALRLRHRFTGRWLHSHSFTAPITGFQEVSCFGGETESDGGDLWSVEHTKDKSGFW
QRGLPFRLRHVDSQQVMASDPAYRYNRPIQGQIEVHATKGKNSNSVWTTAEGVFFEPTAQ
AA
Download sequence
Identical sequences A0A059LH77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]