SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059PT28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059PT28
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 6.02e-35
Family Glycoprotein B-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059PT28
Sequence length 101
Comment (tr|A0A059PT28|A0A059PT28_HCMV) Glycoprotein B {ECO:0000313|EMBL:AGN92818.1} OX=10359 OS=Human cytomegalovirus (HHV-5) (Human herpesvirus 5). GN=UL55 OC=Betaherpesvirinae; Cytomegalovirus. OH=9606
Sequence
ELERLANRSSLNLTHSRTKRSADGNNATHLSSMESVHNLVYAQLQFTYDTLRGYINRALA
QIAEAWCVDQRRSLEVFRELSKINPSAILSAIYNKPIAARF
Download sequence
Identical sequences A0A059PT28 A0A059PV87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]