SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059SZG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059SZG5
Domain Number 1 Region: 29-115
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 113-208
Classification Level Classification E-value
Superfamily Immunoglobulin 9.48e-16
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059SZG5
Sequence length 275
Comment (tr|A0A059SZG5|A0A059SZG5_9SAUR) MXRA5 {ECO:0000313|EMBL:AHG57443.1} OX=109399 OS=Liolaemus boulengeri. GN=MXRA5 OC=Toxicofera; Iguania; Iguanidae; Liolaeminae; Liolaemus.
Sequence
AQTFQTQQNRQQRSSWVMIEQDQHTRFAQSVVEGSVIQLSCNLKASESPSIKWLLPDGTK
LKVPFKMEDNRYSVLSSGQLVIRSVAYADSGMYHCVAQVRNDVDTMSYRVQVQPPVIQPA
ESEIVHVEKNVGDPIFLPCSAVAVPDAHLSWILPNSHVLHDLSNSSNGYLLHNGTLFIPH
SHVKDSGYYRCVAINQQGSDQFCVKVTVNKIISDRSSKRAKFKKHPGSRISVKAREQIIE
DIQGSGDEESDDTPSKKIHLKDHEVSLKQKNDHVS
Download sequence
Identical sequences A0A059SZG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]