SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059XHF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059XHF1
Domain Number 1 Region: 220-397
Classification Level Classification E-value
Superfamily MIR domain 2.09e-39
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1091-1219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-22
Family SPRY domain 0.032
Further Details:      
 
Domain Number 3 Region: 670-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000202
Family SPRY domain 0.083
Further Details:      
 
Domain Number 4 Region: 4214-4273
Classification Level Classification E-value
Superfamily EF-hand 0.0000000253
Family Polcalcin 0.038
Further Details:      
 
Domain Number 5 Region: 103-187
Classification Level Classification E-value
Superfamily MIR domain 0.0000000366
Family MIR domain 0.019
Further Details:      
 
Domain Number 6 Region: 2271-2353
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000209
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059XHF1
Sequence length 5133
Comment (tr|A0A059XHF1|A0A059XHF1_CHISP) Ryanodine receptor {ECO:0000313|EMBL:AIA23856.1} OX=168631 OS=Chilo suppressalis (Asiatic rice borer moth). GN=RyR OC=Pyraloidea; Crambidae; Crambinae; Chilo.
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKENLGKGTGSGHRTLLYGNAILLRHLNSDMYLA
CLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVRVGDDLILVSVATERYL
HTTKENEVSIVNASFHVTHWSVQPYGTGISRVKYVGYVFGGDVLRFFHGGDECLTVPSTW
AREGTQNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWYHPMRIRHITTGRYLAVNDQ
NDLYLVTREEATTASCAFCLRQEKDDQKVVLEDKDLEVIGAPIIKYGDSTVIVQHSETGL
WLSYKSYETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTKF
INGLETLQENRRHSMFFASVNLGGMVMCLEDLINYFAQPDEDMEHEEKQNKFRALRNRQD
LFQEEGILNLILEAIDKINVITSQGFLAGFLAGDESGQSWDMISGYLYQLLAAIIKGNHT
NCAQFANSNRLNWLFSRLGSQASGEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLE
KHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDYLLPGKNLLLQTQLVDHVSSVRPNIFVG
RVEGSAVYQKWYFEVTMDHIEKSTHMMPHLRIGWANTSGYVPYPGVGEKWGGNGVGDDLY
SFGYDGAFLWAGGRKTPVNRTHADEPYIRKGDVIGCALDLTVPIINFMFNGVRVTGSFTN
FNLEGMFFPVISCSSKLSCRFLLGGEHGRLRYAAPEGYSPLVESLLPQQILSLEPCFYFG
NLAKRALAGPPLVQDDTAFVPTPVDTLQITLPSYVEQIRDKLAENIHEMWAMNKIEAGWM
YGDQREDLHKIHPCLVPFERLPPAEKRYDIQLAVQTLKTVLALGYYISLDKPPARIRNVR
LPNEPFMQSNGYKPAPLDLSAVTLTPKMDELVDQLAENTHNLWARERIQQGWTYGLNEDP
EMHRSPHLVPYPKVDDAIKKANRDTASETVRTLLVYGYNLDPPTGEQHEALLLEASKQKQ
ADFRTYRAEKNYAVSSGKWYFEFEILTTGPMRVGWAHADMAPGMMLGQDENSWAFDGYNE
EKVYSGSTESFGKQWAVGDVVGVFLDLIDKTISFSLNGELLMDALGGETTFADVQGDNFV
PACTLGVGQKARLTYGQGVNTLKYFTTCGLQEGYEPFCVNMKRDVTHWYTKDQPIFENTD
EMLDTRIDVTRIPAGSETPPCMKISHNTFETMEKANWEFLRLSLPVICHAEFISEQVKAR
RWVEIKERQQMLMKEATEAQMPAHIDQIMRSGFTMNDIKGLHYEENQEDVSKMKRQPSRP
PRKGSVTRGVTLQGYGQGQVNGMHRSTSEAEMSKYELGVQNLPDEKKEKRGRSPFKFFKS
KRGESGDRAKSRKSKTPDPFSDPELSPDRGPAVRRMPNPQIRVSQANQNYNSMLPRTSKP
NLYGSQAGLNINLPMQKPTQDRKQMITGTLAAATTETVGNEIFDAECLKLINEYFYGVRI
FPGQDPTHVYIGWVTTQYHLHSKDFNQNKVMKSSVIITDDYDRVVESVNRQSCYMVRADE
LYNEVMAEAAGAKGASQGMFIGCSVDTSTGTVAFTCEGKDTTIRFKMEPETKLFPAIFVE
ATSREILQIELGRSSTSLPLSAAVLPTSDKHVNPQFPPRLKVQCLKPHQWARVPNQSLQV
HALKLSDIRGWSMLCEDAVSMLALHIPEEDRCIDILELIEMDKLLSFHSHTLTLYAALCY
QSNYRAAHALCQHVDQKQLLYAIQSQYMSGPLRQGFYDLLIALHLESHATTMEVCKNEFV
IPLGPELKSLYEEPKMGHSLRSLQTESVRPQMKMTDIAESITDISNLYSPYFPLEVVREF
VMQALADAVHTNQVHNRDPVGGSNENLFLPLIKLVDRLLLVGMMRDEDVEKLLIMTNPET
WDPTFDKEGKDEHRKGLLHMKMAEGAKLQMCYLLQHLNDIQLRHRVESIIAFAHDFVGDL
QTDQLRRYTEIKQSDLPSAVAAKKTREFRCPPREQMNAILSFKHLEDEDKENCPCGEELI
ARMNDFHESLMVHVSLTALQETDLGDQNEPETKPGAFGKLYNIINTVKELEEEPKAIEEP
PKKSPEEKFRKVLIQTIVSWAEESQIETPKLVREMFSLLVRQYDAVGELIRALEKTYVIN
AKTKLDVAEMWVGLSQIRALLPVQMSQEEEELMRNRLWKLVNNHTFFQHPDLIRVLRVHE
NVMAVMMNTLGRRAQAQSDAAPNAPQPTDDKERDTSHEMVVACCRFLCYFCRTGRQNQKA
MFDHFDFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCG
LQSNSELVEKGYPDLGWDPVEGERYLDFLRFRVWVNGESVEENANLVIRLLIRRPECLGP
ALRGEGEGLLKAIVDANKMSERIADRTKLREMEQEGDVNFHHPLPESDEDEDYIDTGAAI
LNFYCTLVDLLGRCAPEASVIALGKNESLRARAILRSLVPLEDLQGVLSLRFALNNPAAG
EERPKSDMPSGLIPGHKQSVGLFLERVYGIETQELFYRLLEEAFLPDLRAATMLDRNDGC
ESDMALSMNRYIGNSILPLLIKHVYFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREA
VSDFLVALTSAMQPSMLLKLLRKLTVDVSRLSEYTTVALRLLTLHYERCAKYYGSTGGQG
IYGASSDEEKRLTMMLFSNIFDSLSKMDYEPELFGKTLPCLIAIGCALPPDYSLSKNYDD
ESYAKETNSSGGPDNPQYDPQPINTSSVALNNDLNTIVQKFSEHHHDAWASRKIENGWVY
GESWSDSQKSHPRLKPYNMLNDYEKERYKEPVRESLKALLAIGWSVEHSEVDIPSTNRSS
MRRQSKSGGRPPEIVTDSATPFNYNPHPVDMTNLTLSREMQNMAERLAENAHDIWAKKKK
EELVTNGGGIHPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPSKASQVDTEQT
TTGVAIGLRFAYSLLEKLIQYIDRATINMKLLKPSTTFSRRSSFKTSTRDIKFFSKVVLP
LMEKYFSTHRNYFIAVATATNNIGAASLKEKEMVAALFCKLASLLRSRLAAFGPDVRITV
RCLQVLVKGIDAKSLVKNSPEFIRTSMLTFFNNVADDLGHTILNLQEGKYAHLRGTHLKT
STSLGYINGVLLPILTAMFDHLANCEYGADLLLDEIQVASYKMLGSLYTLGTDVTLTHDR
KYLKTEIERNKPALGSCLGAFSSTFPVAFLEPHLNKHNQFSLLNRIADHSLEAQDIMAKM
EQSMPTLETILSEVDQFVESDKTYNEAPYIIDVILPLLCSYLPFWWAQGPDNVTPTAGNH
VTMVTAEHMNQLLKNVLKLIKKNIGNESAPWMTRIATYTQQIIINSSEELLRDSFLPLAE
RVRKRTDNMFHKEESLRGFIKSSTDDTSQVESQIQEDWQLLVRDIYSFYPLLIKYVDLQR
NHWLRNNINEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMVLIMPTATRRVTT
VVDGAPQGGGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKD
RFLKKMTEQDVSEFAKTQLTLPDKVDPADEMSWQHYLYSKLGSKSKTNITIETAENKAKI
IDDTVERIVAMSKVLFGLHMIDHPQQMFKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHR
ACNIFARTYYELWLEEENVGQEVMMEDLTQSFEDAELKKSDVVEEEGKPDPLTQLVTTFC
RGAMTERSGALQEDLLYMSYANIIARSCGEEEEEGGGEEEEGGGELEGEEEGRASIHEQE
MEKQKLLFHQARLADRGVAEMVLLHISASKGVPSEMVMKTLELGISILRGGNIDIQMGML
NHLKDKKGVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGLEGAAGEKNMHDAESTCA
LFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELI
DPAGKANFFKAIGVASQVFNTLTEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKL
SKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFD
MFLKLKDLTSSASFQEIDANNDGWVLPKDFKEKMEQQKSYTPEEIEFLLACCETNHDGKL
DYIGFCDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEI
MGGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIF
EMTHASSLMAASEEAAGGPKNREASYMYMGDDDDDRAGKDPFRRGLQSVKEGISAAFSSL
SPSNIKQKIADMQQMPPADLAVGFFKMFFYLFYYLGYGVLVVVRYIFGVLLGLMRGPQTE
EPPPEPTEEEKIGQLRHRLLANTSPTRHLPALPPADDTGQLQVQAFGLDITKEDNGQLQV
KPHESPSTSTPSSGEEADASLEEGTDHAEEQRPPSLIDLLGGEQAKKQAQERMEAQAVRQ
AAMSAIEAESKKAVQGPAPSALSQVDLSQYTKRAVSFLARNFYNLKYVALVLAFCINFVL
LFYKVSSLDSEDGDGSGVGDIIGGSGSGSDSGSGDGGSGESAEDDDSLEVVHIDEDFFYM
EHVIKVVALLHSIVSLAILIGYYHLKVPLAIFKREKEIARRLEFDGLYIAEQPEDDDLKS
HWDKLVISAKSFPVNYWDKFVKKKVRAKYSETYDFDSISNMLGMEKTSFSAQEDEGSKGL
LQFIMTIDWRYQVWKAGVTITDNSFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLR
TILQSATHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYVQEEDDEVNKNCHDMLSCFVF
NLYKGVRAGGGIGDELEPPDGDDSEVYRIIFDISFFFFIIVILLAILQGLIIDAFGELRD
QLESVKEDMESNCFICGINKDYFDKVPHGFDTHVAREHNLANYMFFLMHLINKPDTEYTG
QETYVWNMYTQRCWDFFPVGDCFRKQYEDVMGE
Download sequence
Identical sequences A0A059XHF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]