SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059XRL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059XRL5
Domain Number 1 Region: 220-397
Classification Level Classification E-value
Superfamily MIR domain 3.92e-38
Family MIR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1090-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-22
Family SPRY domain 0.02
Further Details:      
 
Domain Number 3 Region: 669-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000989
Family SPRY domain 0.072
Further Details:      
 
Domain Number 4 Region: 4197-4259
Classification Level Classification E-value
Superfamily EF-hand 0.000000208
Family Polcalcin 0.051
Further Details:      
 
Domain Number 5 Region: 103-186
Classification Level Classification E-value
Superfamily MIR domain 0.000000366
Family MIR domain 0.024
Further Details:      
 
Domain Number 6 Region: 2264-2347
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000392
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 
Domain Number 7 Region: 2648-2727,2757-2797,2839-2861,3191-3437,3615-3663,3852-3868
Classification Level Classification E-value
Superfamily ARM repeat 0.0000487
Family HEAT repeat 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059XRL5
Sequence length 5135
Comment (tr|A0A059XRL5|A0A059XRL5_LAOST) Ryanodine receptor {ECO:0000313|EMBL:AIA23858.1} OX=195883 OS=Laodelphax striatella (Small brown planthopper). GN=RyR OC=Fulgoroidea; Delphacidae; Criomorphinae; Laodelphax.
Sequence
MADSEGGFEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
TCVFVIEQALSVRALQELVTAAGSEEDQDSLGKGTGSGHRTLLYGNAILLRHQNSDMYLA
CLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYL
HTTKENDLSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTW
SEAPGQNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWYHPMRIRHLTTGRYLGVNEN
NELHLIVRDEATTALSAFCLRQEKDDQKVVLEDKDLEVIGAPIIKYGDSTVLVQHSETGL
WLTYKSYETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTQF
IRGLEELQVNRRHSLFCATVNLNEMVMCLEDLINYFAQPADDMEHEEKQNRFRALRNRQG
LFQEEGILNLILEAIDKINVITSQGFLVSLAGDESGQSWDIISGYLYQLLAAIIKGNHTN
CAQFANSNRLNWLFSRLGSQASSEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEK
HGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGR
VVGSAVYQKWYFEVTMDHIEQTTHMTPHLRIGWANTSGYVPYPGGGEKWGGNGVGDDLYS
YGFDGANLWTGGRKTCVLPHATEPFIRKGDVIGVSLDLTVPIIIFSFNGSPIRGCFRDFN
YDGMFFPVLSCSSKLSCRFLLGGDHGRLKYFPPEEFSPLVESLLPQQVLSIDPCFYFGNL
NKCVLAGPWPVEDDTAFVPTPVDTTKVTLPNYIESIRDKLAENIHEMWAMNKIEAGWIFG
EKRDDIRKVHPCLIQFDQLPPAEKRYDSQLAVQTLKTILALGYYITMDKPPSRIKTIRLP
NEPFMQSNGYKPAPLDLTAISLTPKMEELVDQLAENTHNLWAKERIQQGWTYGLNEDSDM
LRSPHLVPYCKVDEAIKKANRDTASETVRTLLVYGYNLDPPTGEAHEALLAEASRQRQLL
FRTYRAEKNYAVSTGKWYFEFEILTAGPMRVGWARSDCPPGSQLGNDEYSWAFDGFNEEK
VYLGTGESFGRQWQVGDVVGVFLDLLDHTISFSLNGELLMDALGGETSFADVQGESFVPA
FTLGIGQKAKLTFGQDVTVLKFFTTCGLQEGYEPFCVNMNRAVTYWYTKDHPIFENTEDY
ADSRIDVTRIPAGSDTPPSLKISHNLFESMERANWEFLRLSLPVICYSTFIEESEKLKRW
QEIRIRQHRLLVEADQTTPAHIEQIMKSGFSMSDIKGLHRGYSEAAVEADEMMMPPQSTP
TTKRKMRQPSRPPRKGSLSRNEDMPMINGSLEQSKMNRSTSELDLNRYNADLQNDKDDKK
RRGRSPFRFFSRKREASNERSKKAKSPEPNSMMEADRGQMSRMQQQHMMRTPTVKVTAPD
MKVMPPGIPERSNLPKQMTGAPLSGSGIESVGNEIFDGECLKLINEYFYGVRIFPGQDPT
HVYVGWVTTQYHFFANEFNQSKVRKVTVHTLDEFSRVNESVDRQSCYMVRADELFNEVTN
DSSGKGASQGMFIGCFMDAATGYITFTCEGKETSHKFKMEPETKLFPAIFVEATSKEILQ
IELGRTSTTLPLSAAVLQNSERHVNPQFPPRLKVQCLKPHQWARVPNVSLQVHALKLSDI
RGWSMLCEDPLSMLALHIPEEDRSIDILELIEMEKLLSFHAHTLTLYAALCLQSNYRAAH
TLCTHVDEKQLLYAIRSDYLSGPLRQGFYDILIALHLESHAYTMEVCKNEFIIPVGQDLK
DLYEDPEMCHSLRSLKTESVLPTMKMTDKAEVVDNIRSLYSPQFPLDVVRDFVMAALDEA
VQINQLHNRDPVGGSNENYFLPLLKLVDRLLLVGMLRDEDVMKLLIMFNPETWDTSYEKD
GKDEHRKGLLHMKMAEGAKLQMCYLLHHLNDIQLRHRVEAIISFSIDFVGDLQADQLRRY
IEIKQSDLPSAIAAKKTREFRCPPREQMNAILGFKNLEEGDTENCPCGDELRERLNSFHE
KLTHKVSLLALQEPSEEETSAEDLKKPSALNRLYNFINAVKELEETPQIEEEPEKKTPEE
IFRKVLISTIVKWAEETQIESPKLVREMFSLLVRQYDTVGELIRALEKTYVINSKTKEDA
TLMWVGLSQIRALLPVQMSQEEEGLMRERLWKLVNNHTFFQHPDLIRVLRVHENVMAVMM
QSLGRGAQAQSDAPQAGQEGEPVSKEKDTSHEMVVACCRFLCYFCRTSRQNQKAMFDHFA
FLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGPQSNSE
LVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEG
EGLLRAIVDANKMSERIADRRKYMDEPEGTTMVTQFEHPLPESDDDEDYIDTGAAILAFY
CTLVDLLGRCAPDSSVIAQGKNESLRARAILRSLVPLEDLQGVLSLKFTLQNPAAGEERP
KSDMPSGLIPGHKQSVVLFLERVYGIETQELFFRLLEEAFLPDLRAATMLDRNDGSESDM
ALAMSRYIGNSILPLLITHSKFYNEADNYASLLDATLHTVYRLSKNRMLTKGQREAVSDF
LVALTSSMQPSMLLKLLRKLTVDVSKLTEYTTVALRLLTLHYDRCAKYYGSTGGQGLYGS
SSDEEKRLTMMLFSNIFDSLSKMDYDPELFGKALPCLTAIGCALPPDYSLSKNYDDELYG
ARDSQAGPSDGPYNPQPINTQSVVLNNDLNTIVQKFSEHYHDAWASRKLENGWTYGEQWS
DSQKTHPRLKPYNMLNDYERERYKEPVRESIKALLAIGWTVEHSEADVPLTSRGSIRRQS
KPNAMVDSSPPFNYHPNPIDMTNLTLSREMQNMAERLAENAHDIWAKKKKEELITCGGGI
HPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPSRTGGPSESEQLAAQATGELR
FAYSLLEKLIQYIDRASINMKLLKPSTTFSRRSSFKTCTRDIKFFSKVVLPLVEKYFSTH
RNYFIAVATASNNVGAASLKEKEMVASLFCKLANLLRSRLAAFGADVRISVKCLQVLVKG
IDAKSLVKNCPEFIRTSMLTFFNNTADDLGHTIQNLQEGKYSHLRGAHLKTSTSLFYIND
VILPVLTAMFDHLAACEYGGDLLLDEIQVASYKMLGSLYTLGIDHTLTHDRKYLKTEIER
HRPQLGSCLGAFASTFPVAFLEPHLNKHNQFSLVNRIADHSLEAQDILSRMESTMPTLDN
ILSEVDQFVESDKTHNDAPHIIDVIMPMLCSYLPVWWNQGPDNVALTAGNYVTMVTSEHM
NQLLKNVLKMIKKNIGNESAPWMTRIAAYTQQIIINSSEELLKDPFLPLAERVKKRTDAM
FHKEESLRGFIKSASDDTSQIEAQIQEDWQLLVRDIYSFYPLLIKYVDLQRNHWLRNNIS
EAEDLYNHVAEIFNTWSKSQYFLKEEQNFISANEIDNMVLIMPTATRRNAVVSDSAAPPG
GSGKKKKKNREKKRDKDKELQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRFLKKMQ
EYEIVEFAKTQLTLPDRLDPGDEMSWQHYLYSTLGSKKEIAEGGKPEQIDAVVDRIVAMA
KVLFGLHMIDHPQLQSKASYRSVVSTQRKRAVIACFRQLSLHALPRHKAINIFARTYYEL
WLTEENVGTEVLIEDLTQSFEDAELKKAQEEVDEGKSDPLTQLVTTFCRGAMTERSGALQ
EDPLYMSYAEIAAKSCGEEEEEGGDEEEGGEGEEQGASIHEQEMEKQKLLFHQSRLANRG
VAEMVLLHISACNGVPSEMVEKTLQLGISILRGGNIDIQMGMLNHLKDKKDVGFFTSIAG
LMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCTLFRFIQLTCEGHNLEWQ
NYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDPAGKANFFKAIGVASQ
VFNTLSEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKNSSQVDLLKELLNLQ
KDMITMMLFMLEGNVVSGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTESPTFMEI
DPNHDGWVLPKDYKEKMEQQKSYTPEEISFMLQCCETNHDGKVDYVGFCDRLHEPSKEIG
FNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEIMGSSKRIERVYFEIKES
NIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMSVDDDSGG
GGGKARKAAYTYISEEDEEKNAKDPIRRTIQAFKDSIYFILTMLSPSNIKTKINEMQQMS
VPELVVGFFKMFFYMFYYSGFSVSVVLRYFGRILMTLMRGPQTEEPVEAVKKDDEFMIGS
MRALPPPLPDAKETSSPSTETKDDSGQAKPTDGSAALALTAGGEEHKEGGTSEEGAEDGS
KPEGAETTEGTQHHITPADLLGGEAARKEAVARAEVAAEQQAVMAAVEAEAKHEVVSEPS
AFSQIDFNGYTHRAVSFLARNFYNLKYVALVLAFCINFILLFYKVTTLGEDDDDGDGGSG
ELGGGLADDLLEELGGGGSGEEGGGVSGGGGVSGENGGGSAEEEDPVEWVHVNEDFFYMA
HVMKIAAMLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLYIAEQPEDDDIKSH
WDKLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISTLLGMEKTSFSSQETEEGTGII
NFILNIDWRYQIWKAGDTITDNAFLYSLWYFIFSILGNFNNFFSAAHLLDVAVGFKTLRT
ILQSVTHNGKQLVLTVMLLTIIVYIYTVIVFNFFRKFYVQEEDEEIDKKCHDMLTCFVFH
LYKGVRAGGGIGDEIEPPDGDDYEVYRIMFDITFFFFVIVILLAIIQGLIIDAFGELRDQ
LESVKEDMESNCFICGIGKDYFDKVPHGFDTHVQQEHNLANYMFFLMHLINKPDTEYTGQ
ETYVWNMYQQRCWDFFPVGDCFRKQYEDELGGGGG
Download sequence
Identical sequences A0A059XRL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]