SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060ABC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A060ABC5
Domain Number - Region: 48-152
Classification Level Classification E-value
Superfamily MIR domain 0.000602
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060ABC5
Sequence length 175
Comment (tr|A0A060ABC5|A0A060ABC5_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AIA64160.1} KW=Complete proteome; Reference proteome OX=1500386 OS=Staphylococcus phage 6ec. GN=PHAGE6E_134 OC=Sextaecvirus.
Sequence
MNKSKTLIYIDSLLLSYEIKQESIGADIDIVDVIGTTEVNNIIYLALEVEYNDYCYLTHV
ELVNMWAYPNDDDKQEIKEELLNNIFKDIAFQSSSINVGDVVRYTDDIYIKNIKNDYFFL
SDNETPKMDVNYIVSDLHYDGIDEQNNLIVLYQLEKDDEYLGILTNEFEIEKVSE
Download sequence
Identical sequences A0A060ABC5
gi|658310448|ref|YP_009042639.1| YP_009042639.1.74189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]